KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_0154Help
Entry
PC1_0154          CDS       T00934                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:pct01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:pct01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pct00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pct00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:pct00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(183401..184168)
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSTHMVNELIAGLRKELSTVDGCGVAIAPPAIYLDQANHQLAGSRIA
LGAQNVDVNLSGAFTGETSADMLKDIGAKYIIIGHSERRTYHKESDEFIAKKFGVLKDAG
LIPVLCIGETEAENEAGQTEAVCARQLDAVLNTLGAKAFENTVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKQDAAVAEQVIIQYGGSVNAANAAELFTQPDIDGALVGGASLKAD
AFAVIVKAAADAKRG
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatccattagttatgggtaactggaagctgaacggcagcactcacatggtcaac
gaactgatcgcgggcttgcgtaaagagctcagcaccgttgacggctgtggcgtagcgatt
gcaccaccggcgatctacctcgatcaagctaatcaccaactggctggcagccgtattgca
ctgggcgcgcagaacgttgacgtaaacctctctggtgccttcaccggtgaaacctctgcc
gacatgctgaaagacatcggcgcgaaatacatcatcatcggccactccgagcgccgcacc
taccacaaagaaagcgacgaattcattgcgaagaaatttggcgtgctgaaagacgcgggc
ctgattccggtgctgtgcattggcgagaccgaagcggaaaacgaagcaggccagacggaa
gcggtatgtgcacgtcagttggatgccgtgctgaacacgctgggcgcgaaagcgtttgaa
aacaccgttatcgcctacgaacctgtatgggctatcggtaccggtaaatctgcgacccct
gcgcaggcgcaggccgttcacaaattcatccgcgatcacatcgccaagcaagatgccgcg
gttgctgaacaagttatcatccagtacggcggttcggttaatgctgcgaatgccgcagag
ctgttcacgcagccggatatcgacggcgcgctggttggcggagcatcactgaaagccgac
gcctttgccgttatcgtgaaagccgcagccgacgcgaaacgcggctaa

DBGET integrated database retrieval system