KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_0159Help
Entry
PC1_0159          CDS       T00934                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pct00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    PC1_0159
Enzymes [BR:pct01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     PC1_0159
Exosome [BR:pct04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PC1_0159
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(187700..189211)
Genome map
AA seq 503 aa AA seqDB search
MNPEKKYIVALDQGTTSSRAIVLDHDANIVSVSQREFTQIYPKAGWVEHDPMEIWASQSS
TLVEVLAKADISSDEVAGIGITNQRETTVVWEKESGKPIYNAIVWQCRRTADICEKLKKD
GLEEYVRNTTGLVVDPYFSGTKVKWILDHVEGSRERAKRGELLFGTIDTWLIWKMTQGRV
HVTDYTNASRTMLFNIHTLEWDTRMLEALDIPREMLPEVRASSEVYGQTNIGGKGGTRIP
IAGIAGDQQAALYGQLCVNPGQAKNTYGTGCFLLMNTGKEAVLSKHGLLTTIACGPRGEV
NYALEGSVFVGGASIQWLRDELKLIGDSMDSEYFATKVKDTNGVYVVPAFTGLGAPYWDP
YARGAIFGLTRGVNANHIIRATLESIAFQTRDVLDAMQADADTRLKALRVDGGAVANNFL
MQFQSDILGTRVERPEVRESTALGAAFLAGLATGFWNDLDEVKSKATIEREFRPSIETVE
RNYRYSGWQKAVARARNWEDHDA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgaacccggaaaaaaaatacatcgtcgcactcgaccagggcacaaccagctcccgcgcc
atcgtgttggatcacgatgccaacatcgtgagcgtttcacagcgtgaattcacccagatc
tacccaaaagcgggctgggtagagcatgacccgatggagatttgggcatcacagagctca
acgttggtcgaagtgctggccaaagccgacatcagctcggatgaagtcgcgggcattggt
atcaccaaccagcgtgaaaccaccgtcgtctgggaaaaagagagcggcaagccgatttat
aacgccattgtctggcagtgtcgtcgtaccgcggacatttgcgaaaagctgaagaaagac
ggtctggaagagtacgttcgcaacaccaccggactggtggtcgacccctatttctccggc
accaaagtgaaatggattctggatcacgttgaaggctctcgtgaacgcgccaaacgcggc
gaactgctgtttggtacgattgatacctggctgatttggaaaatgacgcaggggcgtgtc
cacgtgacggattacaccaacgcttcccgcaccatgctgtttaacattcatacgctggag
tgggatacccgcatgctggaagcgctggatatcccgcgtgagatgctgccggaagtgcgc
gcatcttcagaagtctacggccagaccaacattggcggtaaaggcggcacacgtattcct
atcgccggtatcgcgggtgaccagcaggcggcgctgtacggccagctttgcgtcaaccca
ggacaggcgaaaaacacctacggcactggctgcttcctgctgatgaataccggtaaagaa
gcggtgctgtccaaacacggcctgctgaccaccatcgcctgcggcccacgcggcgaagtt
aactacgcgctggaaggctcggtattcgttggcggtgcctctatccaatggttacgtgac
gagctgaagttgatcggcgactcaatggactccgaatacttcgcaacgaaagtgaaggac
accaacggcgtctatgtcgtacccgctttcaccggtttaggcgcgccttactgggatccg
tatgcccgtggcgcgatcttcggtctgacccgcggcgtgaacgcgaaccacatcattcgt
gcgacgttggaatccattgccttccagacccgcgatgtactggatgccatgcaggcagat
gccgatacccgcctgaaagcgctgcgtgtcgacggcggtgcggttgccaacaacttcctg
atgcagttccagtccgatattctcggcacgcgcgtggaacgcccggaagtgcgcgaatcc
accgcgctgggtgcagctttcctggcaggccttgccacaggattctggaacgatctggac
gaagtgaagagcaaagccacgatcgagcgcgaattccgccccagcattgaaaccgtggag
cgtaattaccgctacagcggctggcaaaaagctgtggctcgcgcccgtaactgggaagat
cacgacgcctaa

DBGET integrated database retrieval system