KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_0199Help
Entry
PC1_0199          CDS       T00934                                 

Definition
preprotein translocase subunit SecE
Orthology
K03073  
preprotein translocase subunit SecE
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
Protein export
Bacterial secretion system
Module
Sec (secretion) system
Brite
KEGG Orthology (KO) [BR:pct00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03060 Protein export
    PC1_0199
 Environmental Information Processing
  Membrane transport
   03070 Bacterial secretion system
    PC1_0199
Secretion system [BR:pct02044]
 Sec (secretion) system
  Bacterial Sec-SRP protein [MD:M00335]
   PC1_0199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
235650..236033
Genome map
AA seq 127 aa AA seqDB search
MSANTEAQDSGRGLEVIKWLVVGALLVVAIVGNYYYREFSLPLRALAVVILIAAAGGVAL
LTTKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS
FITGLRF
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcgaataccgaagctcaggatagtgggcgtggcctggaagtgattaagtggctg
gtagtaggtgccttgctggttgttgcgattgttggcaattattattaccgcgaatttagt
cttcccctgcgtgcattggccgttgttatcctgatcgccgcagccggtggtgtggcactg
ctgaccacgaaaggcaaagcaaccgtagcgtttgctcgcgaagcgcgcactgaagtgcgc
aaagtaatttggccgactcgtcaggaaacgttacacaccacgttaatcgttgccgcggtg
actgccgtgatgtcactgattttgtggggactggatggtattctggtccgtttggtatcg
tttatcactggcctgaggttctaa

DBGET integrated database retrieval system