KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_0268Help
Entry
PC1_0268          CDS       T00934                                 

Definition
cytochrome P450
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pct00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    PC1_0268
  Amino acid metabolism
   00380 Tryptophan metabolism
    PC1_0268
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    PC1_0268
Enzymes [BR:pct01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     PC1_0268
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     PC1_0268
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
316445..319624
Genome map
AA seq 1059 aa AA seqDB search
MSGKTAVPQPPIKPVIGNLADVDPRNSIDSLMKLAKTYGPFFKMRIFSDEFYVASSQELV
NELSDESFFEKKLSAELLELRYLGGDGLFTAHTHEPNWGKAHRILMPALGPLGVRSMFDK
MLDISEQMFLRWERFGPDVDIDVADNMTRLTLDTIALCGFDYRFNSFYRDDLLPFVKAIV
GSLKEAGLRVRRPGIVNKLMIPSTRQYRTDKALMYSVVEQLIAARKMDPKASEKNDLLNR
MLNGVDPQTGEKLSDENIAHQMLTFLVAGHETTSGMLSFTVYFLLKNPNVLNKARAIVDE
VLGDEIPRIEHLAQLRYLEQILMESLRMWPTAGGHVVSPTQDTILAGKYPLTPKDSIVIL
QPQLHRDVKAWGDDANLFKPERFGPDNAENLLPNSWQPFGSGKRACIGRMFAMQEAQLVL
AMMLQRFDFELSDPSYELKIVEHLTIKPDNLKIRIRVRKPSKTLARGVTPKETSNKMAVM
PVAKAQHHQDLIPLLVLHGGNTGSSEAFANRIAADAQRYGFASTLAALDDYAEKLPQTGA
LIVITASYEGMPPNNARHFVPWVEGLADDALSGLKFSVFGCGNLQWVRTYQAIPKRVDLA
LEHAGGERIHERGVADSGGDFFGNFDDWYTKLWPALTTAFGRQGAVAEDATELELEFVHT
DRVSTLQIPDMGRGVVVENRELVDMTSPFARSKRHIEIRLPEGMAYRAGDYLAVLPRNSD
DQIDRVLRRFGLSPDMMLVINQAPDVTGLPIGQPISCAELLGNYVELSQPATRAQVAALA
AATRCPPEKMELEKLATEHYENDVLAPRLSVLDLLYRFQSCPTDFRRYLTMLPSIKARQY
SISSSPAWKPDHVTLTVAVVDSPALSGIGRYKGVASNYLASLKPDDRIAIVVRPSSPFFH
LPDDPSIPIILIGAGSGIAPFRGFLQERALQQAAGVRVGPALLFFGTGHPDVDYLYRDEL
AAWEKSHIVTVLPAFSHQPDGEVTFVQHRVWADRERIKTLFCNGGSLFVCGDGLRMVPEV
RDMLLRIYREATGSNETDAMLWADKLEREQGRYVVDMFI
NT seq 3180 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggaaagacagctgttccccaacctcccatcaaaccggtcattggcaatttggct
gatgtggatccccgtaatagcatcgacagtttaatgaaattagcaaaaacatacggccca
ttctttaaaatgcgaatttttagcgatgagttttatgttgcctcctctcaggaactcgtg
aacgagctgagtgatgaaagtttctttgagaaaaagttaagtgcagaattactcgaatta
cgttatctaggcggtgatggactttttacggctcatactcatgagcctaattggggtaag
gcgcatcgaattttgatgccagcattaggcccgctcggtgttcgctcgatgttcgataag
atgctggatatttcagagcagatgtttttgcgttgggagcgttttggccccgatgtcgat
attgatgttgctgataatatgacccggttaacgctggatacgatcgctctctgtgggttc
gattatcgcttcaatagcttctaccgtgatgatttgctgcctttcgtgaaagcaatagtc
ggttcgcttaaagaggccggtttacgtgtacgccgacctggaatcgtgaacaaattgatg
attcctagcactcgccaataccggacagataaagcgctgatgtattcagtggtagagcaa
ctgatcgcggcgagaaaaatggatccgaaggcgagtgaaaaaaacgatctgctcaatcgc
atgttgaatggcgtcgatccgcaaaccggggaaaaactgtctgatgagaatattgctcat
cagatgttgacgtttttggttgcgggccatgaaaccaccagcggtatgctttcttttact
gtttattttttgttgaaaaatccaaacgttctgaataaagcgcgggctatcgttgatgag
gttcttggggatgaaataccccgtattgagcaccttgctcagctacgctatctggaacag
atactgatggaaagtttgcgtatgtggcctactgccgggggccacgtcgtgagtcccaca
caggatacgatattggcgggtaaatacccccttacgccaaaagattcgatcgtcatcctt
caaccgcagcttcatcgtgatgtcaaagcgtggggggatgatgccaatctgttcaaacca
gagcgattcggaccagataatgcagagaatttgctgccaaattcctggcaaccctttggc
tccggcaaacgcgcctgcattggaagaatgtttgctatgcaggaagcacagcttgtactg
gcaatgatgttgcagcgttttgattttgaactgagtgatccttcctatgagctgaagatc
gtcgaacatctgacgattaaacccgataacttgaaaatccgcattcgggtgcgtaaaccg
tcaaaaacgctggcacgaggtgtcacacccaaagagacctcaaacaagatggccgtgatg
cctgtggccaaggcacagcaccatcaggatcttatccccttattggtgctgcatggcggc
aataccggatcttcagaagcattcgctaaccgtatcgcggctgatgcacagagatacggt
tttgcctctacgctcgcagcgctggatgattatgctgagaaattaccgcaaaccggtgca
ctcattgttatcactgcctcttatgaagggatgccgccgaacaatgcacgccattttgtc
ccttgggttgaggggctggcggatgatgcactgtcagggctgaaattcagcgtatttggt
tgtggtaacttacaatgggtgcgcacctatcaggcgatacccaagcgagtggatctcgct
cttgaacatgcagggggggagcgtatccatgagcggggcgttgccgattctggtggggat
tttttcggcaattttgacgactggtacaccaaactctggcctgcgctgacaacggcattc
ggtagacagggagccgtggctgaggatgcaactgaactcgaactggaatttgttcatacc
gatcgcgtcagtacattacagattcccgatatgggacgtggggttgtggttgaaaatcga
gaacttgtcgacatgacatcacctttcgcacgttcaaaaaggcatattgaaatcaggttg
ccggaagggatggcataccgagcgggagattaccttgccgtattgccgagaaactcagat
gatcagatagatcgcgtattacggcgttttggtctgtcacccgatatgatgcttgtcatt
aatcaagctcccgatgtcacggggttgccgattggacaacccattagctgtgcagagttg
ttgggaaactatgttgagctgtcgcaaccggctacgcgggcacaggtcgcagcattggcg
gcggcaacacgctgcccgccggaaaaaatggaacttgaaaaactggccacggagcattac
gagaatgacgtgctggcaccgcgtttgagcgtgctggatctactttatcgcttccaatct
tgtccgactgattttcgtcgctaccttacaatgctgccatctattaaagcacggcagtac
tcaatatcatcatcgccagcatggaaaccggaccacgttacgcttactgtcgcggtcgtc
gattcgccagcgttatccggtataggccgttacaaaggcgtcgcctccaactaccttgct
tctctgaaacctgacgatcgtatcgccattgtggtacgcccttctagcccgtttttccat
ctaccggatgatccttcgataccgattattttgatcggtgcaggttcagggatagcgcca
tttcgtggttttctacaggaacgtgcattgcagcaggcggccggagtgagggttggtccg
gcgctattgttttttggcacaggccatcccgatgtcgattatctctatcgcgatgagctt
gccgcctgggagaaaagtcatattgtgacggtgttgcctgcattttcccatcagcctgat
ggggaggttaccttcgttcagcatcgcgtttgggctgacagggagcgtattaagacgctc
ttttgcaacggtggttctctctttgtttgcggggatggtttgcggatggtccctgaggta
cgagacatgctgctccgtatttaccgcgaagcgacagggagtaacgaaacggatgccatg
ctctgggctgataaacttgagcgggagcaagggaggtatgtggttgatatgttcatctga

DBGET integrated database retrieval system