KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_0476Help
Entry
PC1_0476          CDS       T00934                                 

Definition
phosphoenolpyruvate phosphomutase
Orthology
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
Phosphonate and phosphinate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pct00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    PC1_0476
Enzymes [BR:pct01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     PC1_0476
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
562021..562953
Genome map
AA seq 310 aa AA seqDB search
MSVILSNHTPTDSYKGCTPGSRRSALRELLRQQKGIRVMEAHSPLSALLIEQAAYEDGDI
HYQFDAFWSSSLTDSTLRGKPDTELVDISHRFHAITEIFDVTTRPLIFDGDTGGQTEHLA
HRIRAAENLGISAMIIEDKTGLKKNSLFGNDVKQTQASVEDFCEKITTAKKAQLTPEFML
IARIESLILDVGMEDAINRALRYADAGADGIMIHSRHKNPSEILAFARQFREHYPHLPLV
CVPTSFNDITFDQLIDGGFNIVIYANHMLRAAYPAMKSILPEILKHGRTLEVEDKCMSIK
DILDLIPGTR
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgtctgttattttatctaatcataccccgacggattcctataaggggtgcacgccgggt
tcacgccgcagtgcgctccgtgaattattacggcagcaaaaaggcattcgtgtgatggag
gctcacagtccgctttctgctttattaattgaacaagccgcttatgaagatggcgatatt
cattatcaatttgatgcattttggtctagttcactcaccgattctactttacggggaaaa
cccgatacggagttggtcgatatcagccaccgtttccatgcgattacggaaatatttgat
gttaccactcgcccattaatttttgacggcgatactggcgggcaaacggagcatttggct
caccgtattcgggctgccgaaaatctgggtatttccgccatgattatcgaagataaaacg
ggtctgaagaagaactctttatttggtaatgatgtaaagcaaacgcaggcttccgtagag
gatttttgcgaaaaaattacgaccgccaaaaaagcacaactgacgcctgagttcatgctg
atcgcccgtattgagagcctgattctggacgtcggcatggaagatgcgatcaaccgtgcc
ctgcgttatgctgatgcgggtgctgacgggattatgatccacagtcggcataagaaccct
tccgaaattttagctttcgccaggcaattccgcgagcattacccacatttacctctggtt
tgcgtgcccaccagttttaacgatattacgttcgatcagctgattgatggcggatttaat
atcgtgatttatgcaaaccatatgttacgtgcggcttatcctgcaatgaagtcaattttg
ccggaaatcctcaagcatggccgaacactggaagttgaggataaatgcatgtcgataaaa
gatattcttgatcttatacccggtacgcggtag

DBGET integrated database retrieval system