KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_0600Help
Entry
PC1_0600          CDS       T00934                                 

Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pct00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    PC1_0600
Enzymes [BR:pct01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     PC1_0600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
699490..700818
Genome map
AA seq 442 aa AA seqDB search
MFLIQEIIRKKRDGKALSEEEIRFFINGIRDNTVSEGQIAALAMTIYFHDMSMDERVALT
LAMRDSGTVLDWKSLNLNGPLVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHT
GGTLDKLEAIPGLDIFPNDDDFRRIIQQVGVAIIGQTSSLAPADKRFYATRDITATVDSI
PLITASILAKKLAEGLDALVMDVKVGSGAFMPTYALSEQLAQAIVGVANNAGCRTSALLT
DMNQVLASSAGNALEVREAVRFLTGESRNPRLYDVTMALCGEMLLAGGLASSADDAHSRL
QAVLDNGKAAEVFGRMVAAQRGPGDFVEHYDRYLPVATLSKPVFATREGIVTAMDTRALG
MAVVSLGGGRRQATDTIDYSVGLDSMISLGERVDAQRPLAVIHANTEAQWQQAANDVRAA
IQLGDTAPEKTPMVYRRVSAEA
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
ttgtttctgattcaggaaattattcgtaagaagcgtgacggaaaagcgctaagcgaagaa
gagatccgcttctttatcaacggtattcgtgacaataccgtctctgaaggccagatcgcg
gcactggcgatgaccatttattttcatgacatgtcgatggatgaacgtgtggcgctgacg
ctggcgatgcgtgattccggtacggtactggactggaagagtttgaacctgaacggcccg
ctggtggacaaacactctaccggcggcgtgggtgatgtcacttcgctgatgctggggccg
atggtcgctgcctgcgggggatacgttccgatgatttctgggcgtggcttgggacatacc
ggtggcacgctagataagctcgaagcgattccgggattggatatcttcccgaacgatgac
gattttcgtcgcatcatccagcaggtcggcgtcgcgattattgggcagacctcctcgctg
gctccggcggataagcgcttttacgccacgcgtgacattaccgccacggtcgactccatc
ccgctcattaccgcgtcgattctggcgaagaagctggctgaagggctggatgcgttggtg
atggacgtcaaagtggggtctggggcgtttatgccgacctacgcgctgtccgaacagctg
gcgcaggcgattgtcggcgtagcgaataacgcgggatgccgcaccagtgcactgctgacg
gacatgaatcaggtgctggcttctagcgcgggtaatgcgctggaagtgcgggaagccgta
cgtttcctgacgggagagagccgcaatccgcgtctgtatgatgttactatggcgctctgt
ggcgagatgctactggcgggtgggctggcaagttcggcagacgacgcgcattcacgcctg
caggcggtgttggataacggcaaagccgctgaagtctttggtcgcatggtggccgcacag
cgcggcccaggtgattttgtcgaacactacgatcgctacctgccggtggcgacattgagt
aagccagtgttcgcgacgcgggaaggtatcgtgacggcgatggacacccgcgcgctgggc
atggcagtcgtatcgctgggcggcggacgccgtcaggctaccgatacgatcgattacagc
gtcggtctggatagcatgatcagcctgggtgagcgcgttgacgcgcagcgcccgctggcg
gtgatccatgccaatacggaagcgcaatggcagcaggcggcgaatgacgttcgcgccgca
atccaactgggtgacacggcaccagaaaagaccccgatggtctatcgccgggtgagcgcg
gaagcgtga

DBGET integrated database retrieval system