KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_0612Help
Entry
PC1_0612          CDS       T00934                                 

Definition
(GenBank) DNA polymerase III psi subunit
  KO
K02344  DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
pct00230  Purine metabolism
pct00240  Pyrimidine metabolism
pct01100  Metabolic pathways
pct03030  DNA replication
pct03430  Mismatch repair
pct03440  Homologous recombination
Module
pct_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:pct00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PC1_0612
   00240 Pyrimidine metabolism
    PC1_0612
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    PC1_0612
   03430 Mismatch repair
    PC1_0612
   03440 Homologous recombination
    PC1_0612
Enzymes [BR:pct01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     PC1_0612
DNA replication proteins [BR:pct03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     PC1_0612
DNA repair and recombination proteins [BR:pct03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     PC1_0612
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_III_psi CSTF_C
Motif
Other DBs
NCBI-ProteinID: ACT11667
JGI: PC1_0612
UniProt: C6D8V9
Position
complement(712009..712422)
Genome map
AA seq 137 aa AA seqDB search
MESRRDRLLQQLGITQWTLRRPTVLQGEIAVSLPAQVRLVIVSAEPLADDEPLLADVLHS
LALTPSQAYRLTPQQIEMLPADVRCHSWRLGIEEPIALQGVQLSSPLLSELYQNADAKRA
LWQQICEHEHDIFSDAS
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atggaatcaagacgtgacaggctgctacagcaactgggaattacgcagtggacgctgcgt
cgcccgacggtgctgcaaggcgaaatcgccgtcagtctgcccgcacaggtgcgtctggtg
atcgtctccgccgagccgctggccgatgatgaaccgctgttggccgatgtcctgcacagt
ctggcgctgactccttcacaagcctatcgcctgactccgcagcagatcgagatgctgccc
gccgacgtacgctgccatagctggcggttgggcattgaagagccgattgcgctacagggc
gttcagctttccagccctctgctttccgaactttatcaaaatgccgacgccaaacgggcg
ctgtggcaacagatctgtgaacatgaacacgatatcttctctgacgccagctga

DBGET integrated database retrieval system