KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_0646Help
Entry
PC1_0646          CDS       T00934                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
748548..749264
Genome map
AA seq 238 aa AA seqDB search
MKKGLLLLSLLVATATNFAHADDAAIKQTLTRLDMQGAEILPSPMAGMKTVITDSGVLYI
SEDGKHLLQGPLYDVSGTMPVNTTNKILIGKMDALQEQMIVYKAAQEKHVITVFTDITCG
YCHKLHEQMKDYNALGITVRYLAFPRQGMKSPAAKDMQSIWCVADRNKAFDSAMKGDAIS
PATCKTDIAAHYQLGIQFGVQGTPAIVLQDGMVVPGYQGPKEMLAMLEAHKASKKTGG
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagggttattactgctttctttactggtagcgacggcaactaactttgctcac
gccgatgatgccgcgatcaaacagacgttgacgcgtctggatatgcagggggcggaaatc
ctgccttcgccgatggcgggtatgaaaaccgtcattaccgatagtggcgtgctgtatatc
agcgaagacggcaagcatttgctgcaaggcccgctttatgacgtgagcggcaccatgccg
gtcaacaccaccaataaaatcctgatcggcaagatggatgcactacaggaacagatgatt
gtttataaagccgcgcaggaaaaacacgttattactgttttcactgacatcacctgcggc
tattgccacaaactgcatgaacagatgaaagattacaacgcgctgggcattaccgtgcgt
tatctggccttcccgcgtcagggcatgaaatcgccagcagcaaaagatatgcagtccatc
tggtgcgtggccgatcgtaataaagcgtttgatagcgcgatgaagggcgacgcgatctcg
ccagcaacgtgcaaaaccgatatcgccgcgcattaccaactgggcatccagtttggcgtg
cagggcacccctgctatcgtgctgcaagacggtatggtcgtgccgggataccaagggcca
aaagaaatgctggcgatgctggaagcacataaagcctcgaagaaaaccggcggttaa

DBGET integrated database retrieval system