KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_0685Help
Entry
PC1_0685          CDS       T00934                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
pct00010  Glycolysis / Gluconeogenesis
pct00620  Pyruvate metabolism
pct00640  Propanoate metabolism
pct00680  Methane metabolism
pct01100  Metabolic pathways
pct01110  Biosynthesis of secondary metabolites
pct01120  Microbial metabolism in diverse environments
pct01130  Biosynthesis of antibiotics
pct01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pct00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PC1_0685
   00620 Pyruvate metabolism
    PC1_0685
   00640 Propanoate metabolism
    PC1_0685
  Energy metabolism
   00680 Methane metabolism
    PC1_0685
Enzymes [BR:pct01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PC1_0685
Lipid biosynthesis proteins [BR:pct01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PC1_0685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ACT11740
JGI: PC1_0685
UniProt: C6D932
Position
complement(803092..805053)
Genome map
AA seq 653 aa AA seqDB search
MTQHNKHAIPTAIAENALINAQQYENMYRLSVDDPAAFWGEQGKIVDWIKPYKTIKNTSF
DPGHISIRWFEDGTLNVAANCLDRHLAERGDQTAIIWEGDDATESKKVTYRELHQSVCRF
ANVLKSQGVKKGDVVAIYMPMVPEAAVAMLACARIGAIHSVIFGGFSPEAISGRIIDSSA
KLVITADEGVRAGRVIPLKKNIDEALKNPNVTTISSVIVFRRTGKIGEWKEGRDLWWHDL
VEKADDHCPPEEMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAALTFKYVFDYHPGDI
YWCTADVGWVTGHSYLLYGPLACGAITLMFEGVPTWPDARRMAQVVDKHQVNILYTAPTA
IRALMAEGDKAIEGTSRESLRIMGSVGEPINPEAWEWYFNKIGNGKCPIVDTWWQTETGG
FMITPLPGAIEAKAGSATRPFFGVQPALVDNLGNPQEGTAEGNLVIVDSWPGQARTLFGD
HDRFEQTYFSTFKGMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVAHP
KIAEAAVVGIPHHMKGQAIYAYITLNHGEEPSSELYTEVRNWVRKEIGPIATPDILHWTD
SLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEKLLEEKQAMSTASQ
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgacacaacataataaacatgccattcccaccgcaattgcggaaaatgcactgataaat
gcccagcaatacgaaaatatgtatcggctgtccgttgacgatcccgccgctttttggggt
gagcagggaaagatcgtcgattggatcaaaccttataaaacgatcaagaacacctcattc
gaccctggtcatatcagtattcgttggtttgaagacggtacgctaaacgtggcggcaaac
tgtctggatcgccatctggccgaacgtggcgatcaaacggccatcatctgggaaggtgat
gacgcgacagaaagcaaaaaagtcacttatcgcgaactgcaccagtccgtgtgccgtttc
gccaatgtgttgaagtcacagggcgtcaagaaaggcgatgttgttgccatttatatgccg
atggtgccggaagccgccgtagccatgctggcctgcgccagaattggggcgattcactcg
gtgatcttcggcgggttctcccctgaagccatttctgggcgcattatcgattccagtgcc
aagctggttattaccgccgatgaaggcgtacgcgccggacgggttattccgctgaagaag
aatattgatgaagcgttaaagaacccgaacgtcaccaccatttccagcgttatcgttttc
cgccgtacaggtaagatcggtgagtggaaagaggggcgcgatctgtggtggcacgatctg
gttgaaaaagcagacgatcattgcccgccagaagagatgaatgcggaagatccgctattt
atcctttatacatcaggctcgaccggtaaacccaagggcgtgttgcacaccacgggcggc
tatctggtttatgctgcactgactttcaaatacgtcttcgattatcatcccggcgatatt
tactggtgtacggcagatgtcggctgggtcacagggcacagctacctactgtacggccca
ctggcatgcggcgcgattacgctgatgttcgaaggtgtgccaacctggccagacgccaga
cgcatggcgcaagtggtcgataaacatcaggtcaatattctctacaccgctcccaccgcg
atccgcgcgctgatggctgaaggtgataaagcgatcgaaggaacatcacgtgaatcactc
aggatcatgggttccgtcggtgaaccgatcaacccagaagcctgggaatggtactttaac
aaaatcggcaacggtaaatgtcctatcgtcgacacctggtggcaaacggagacgggcggt
ttcatgatcaccccactgcccggcgcgattgaagcaaaagccggctccgcgacacgtccg
ttcttcggtgtacagcctgcgctcgtcgacaacctcggcaaccctcaggaaggtactgcg
gaaggcaatctggtcatcgtggattcctggccgggtcaggcacgcaccctgtttggcgat
cacgatcgtttcgagcaaacctacttttctactttcaaaggcatgtacttcagcggtgac
ggcgcgcgccgtgacgaagatggctattactggatcacgggccgcgttgacgacgtgctg
aacgtttccggccatcgtctggggacggcagaaatcgagtcagcgctcgttgcccatccc
aaaattgccgaagcagctgtggttggcattccacaccatatgaaaggacaggctatttac
gcctacatcacgctgaaccacggcgaagagccgtctagcgagctgtatacggaagttcgc
aactgggtacgtaaagaaatcggcccgattgcgactccggatatcctgcactggactgac
tctttaccgaaaacgcgatccggcaaaatcatgcgtcgtattttgcgtaaaatcgccgcc
ggtgataccagcaatctgggggatacctcaacgctggccgatcctggcgtcgtcgaaaaa
ctgctcgaagaaaagcaggccatgagtaccgcctctcaataa

DBGET integrated database retrieval system