KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_0752Help
Entry
PC1_0752          CDS       T00934                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
pct00010  Glycolysis / Gluconeogenesis
pct00051  Fructose and mannose metabolism
pct00562  Inositol phosphate metabolism
pct01100  Metabolic pathways
pct01110  Biosynthesis of secondary metabolites
pct01120  Microbial metabolism in diverse environments
pct01130  Biosynthesis of antibiotics
pct01200  Carbon metabolism
pct01230  Biosynthesis of amino acids
Module
pct_M00002  Glycolysis, core module involving three-carbon compounds
pct_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pct00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PC1_0752
   00051 Fructose and mannose metabolism
    PC1_0752
   00562 Inositol phosphate metabolism
    PC1_0752
Enzymes [BR:pct01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PC1_0752
Exosome [BR:pct04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PC1_0752
  Exosomal proteins of bladder cancer cells
   PC1_0752
  Exosomal proteins of melanoma cells
   PC1_0752
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACT11806
JGI: PC1_0752
UniProt: C6D9M0
Position
877051..877845
Genome map
AA seq 264 aa AA seqDB search
MKKVMIGTSWKMNKTRQDAMDYCAVLSRQLNDAAGAGIQPFVIPPFTLIREVTEFLSAQK
VNCLTGAQNMHYADSGAWTGEVSPLMVSDCGASLVELGHSERRQHFAENDADIQKKVQAA
LRYQLRPLVCVGDSAQEKAWGVSKETVIRQMKIALAGLHVQQAEKVIIAYEPIWAIGEGG
TPATAQEAQDIHSALRQALVALYGEDIASRITLLYGGSVNPHNTGELIQCADIDGLFIGR
SAWDAENFCQLVRSVSALLNEQGE
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtgatgatagggacgagctggaaaatgaataagacccggcaggatgcgatg
gactactgcgcggtgctatccagacagcttaacgatgcggcgggtgcaggcattcagcct
tttgtcattcccccttttacgctgatcagggaggtgaccgagttcctgtctgcgcaaaag
gtaaactgcctgacaggggcgcagaatatgcactatgctgacagcggcgcgtggactgga
gaggtttctccgctgatggtcagtgattgcggcgcgtcgcttgtcgagctggggcattcc
gagcgccggcagcactttgcggaaaacgatgcggatattcagaaaaaagtgcaggccgcg
ctgcgttatcaactgcgtccgctggtttgcgtaggtgacagtgcgcaagagaaagcgtgg
ggcgtttctaaagaaaccgtcattcggcaaatgaaaattgcgcttgcgggtttacacgtg
cagcaggcggaaaaggtcatcattgcgtatgaacctatctgggccatcggtgaaggggga
acacccgccaccgcacaggaagcgcaagatattcactctgccttgcgtcaggcgctggtt
gccctttatggcgaagacattgcctctcgtattacgcttctgtacggcggcagcgtgaat
ccgcataatacgggcgaacttattcaatgcgccgatattgacgggttatttattggcagg
tctgcatgggatgcggagaatttctgccagctggtgcgcagtgtttcagcattgttgaat
gaacagggtgagtga

DBGET integrated database retrieval system