KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_0849Help
Entry
PC1_0849          CDS       T00934                                 

Definition
Type III site-specific deoxyribonuclease (EC:3.1.21.5)
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Brite
Enzymes [BR:pct01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     PC1_0849
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
987593..990589
Genome map
AA seq 998 aa AA seqDB search
MNHHSQNTGFQFDSHQQYQLDAINAVVDLFDGQPKDADKIAIALRGSVASREGELDLGIE
QVIGAIGNNLVLDEDAILANLQTVQDRNGLEVSEKLVDGKLDFDIEMETGTGKTYVYLRT
VFELAKKYGFTKFIILVPSVAIREGVNTSIRLMRDHFRSLYPAQPFDANVYRGDKAEEVQ
AFATATNVQILVMTIDAVRSDKNKNENKRIIHKPYDKLNGLRPLDYLKGTHPVVIMDEPQ
NMESLLSQSAVVEFDPVFTLRYSATHKQRRNQVYRLDPVDAHDLGLVKQIVVAEVAQHGA
DVAPYVKLLEVNDTKGAKLELACRKADGSIARRSKKVKPHQELSDVTGNPAYKDWRINAL
SIAAFGESASIELTPNGNLLHEGESLGGATGAVYKEMIRETVREHLRKEAMLRPKGIKVL
SLFFVDKVASFLGDGVNNEDANGEFVKWFDEVFMEERGKSDVYQKLLPQEPCELRRAYFS
QLKTRGRTTFVDSSGSAVKDDDAYKLIMQDKQRLLDSDEPVRFIFSHSALREGWDNPNVF
QICTLREMGAETERRQTLGRGLRLPVAKTVKGYERVTDHSVAQLTVVANESYATFAQNLQ
AEYKEAGVAIGQVRSNEFAKLMKRDIHGVMTDDMLGFKTSSAIFKHLENAGFIKDGKTTS
MFLPDAEGFSLHLPDELRPYESDIIRCILNAGIEKYVKPVSARAKRKFNKELYASPDFER
LWSAISQKTTYRVTVKHPMLVEACIKAIKAEPKIQPLRIDVTRAGVRVLRGGTQGQELGA
RTVDLKGSYDLPDIIGELQQGTSLTRKTLVDILIGSGRLDEFIANPNDFMAMVRRCVEGE
LQRVIVEGVQYEKIGGSVYELRELQADGLAENDFFKEHLYRVEHPEKTDFDYVVFDGRPD
SPERKFAEFLDHREDIRLFMKLPPRFQIDTPVGPYNPDWAIIKSEDGEDRIYMVRETKST
MDEQKRRPSENAKIKSAEAHFREIGIEYAVSVPEQWNI
NT seq 2997 nt NT seq  +upstreamnt  +downstreamnt
atgaaccatcattctcaaaatacgggctttcaatttgattcacatcagcaatatcagctc
gatgccatcaacgccgtggtggatttgttcgatggtcagccaaaggatgctgacaagatc
gcgattgccttgcgtggcagcgttgccagccgggaaggtgagctggatttaggcatcgag
caagtaattggtgctatcggcaataatctggtgctggatgaagacgctattcttgctaat
ttacaaacggtacaggatcgcaacgggctggaggtcagcgaaaaactggttgatggcaaa
ctggatttcgacatcgaaatggaaaccggtacgggtaaaacttacgtttatctgcgtacc
gttttcgaactggcaaagaaatatggcttcaccaaatttatcattctggttcccagcgtc
gccattcgtgaaggcgtgaacaccagtattcgcctgatgcgcgatcacttccgtagcctc
tatccggcgcagcctttcgatgcgaatgtctacagaggcgacaaggccgaggaagtacag
gcttttgctactgcaaccaacgtgcaaatactggtgatgacgattgatgcggtgcgtagt
gacaagaataaaaacgagaataagcgcattattcacaaaccttatgacaagctcaatggc
ttgcgtccgttagattacctgaagggcacgcatcccgtggtgatcatggatgaaccacaa
aatatggagtcgttactgtcgcagtcggcagtggtcgagttcgatcccgtattcacgctg
cgctactcggccacgcataagcagcggagaaaccaggtctatcggctcgatccggttgat
gcacacgatctaggtctggtgaaacagatcgtcgtggctgaagttgcacagcacggtgcg
gatgttgcgccttacgtcaaactactggaagtgaacgacacgaaaggtgcgaaacttgaa
ctggcttgccgcaaggccgatggctccatcgcgcgtcgtagcaaaaaggtcaagccgcat
caggaattgtccgatgtcacgggtaatccggcttacaaagattggcgtattaatgcgttg
agcatcgccgctttcggtgaatcagccagtattgaactgacgccgaatggaaacttgctg
cacgaaggtgaatccctggggggcgcaacgggcgcggtttacaaggaaatgattcgggaa
accgtgcgtgagcatttgcgtaaagaggccatgttacgcccgaaagggatcaaggtgctg
agtctgtttttcgtggacaaggtggcaagcttcctcggcgacggggtaaacaacgaagac
gctaatggcgagttcgtgaaatggtttgatgaagtgttcatggaagaacgcggcaagtct
gacgtctaccaaaaattgctgccgcaggagccttgcgaattacgacgagcctatttttct
caactaaaaacacgtggcagaacaacctttgtggattcatctggttcggctgtcaaagat
gacgatgcctacaaactcattatgcaggacaagcaacgcctgctggacagcgatgaaccc
gtacgcttcatctttagccattccgcattgcgtgaaggctgggacaaccccaacgtgttt
cagatttgtacactgcgtgaaatgggcgcggaaacggaacgtcggcagacgctggggcgt
ggtctgcgcctgccggtagcgaaaacagtaaaaggctatgagcgagttaccgaccacagc
gttgcacagctcaccgtggttgctaacgaatcttatgctacgttcgctcagaatctgcaa
gctgaatacaaagaggcgggtgttgccattggacaggtgcgctccaatgaatttgccaaa
ctgatgaaacgggatattcatggcgtgatgaccgatgatatgctgggtttcaagacatct
tctgccatcttcaaacatctggaaaacgcgggattcatcaaggatggtaagacaacttcc
atgtttctgccggatgcagaaggattctcattacatctacctgatgagctcaggccctac
gaatcagatattatccggtgcatccttaatgcgggtattgagaaatatgtgaagcctgta
agtgcgcgggctaagcgtaaattcaataaagagctctatgcctcgccggattttgagagg
ctttggagcgctatcagccagaaaactacttatcgggtgacagttaaacaccctatgctg
gttgaggcgtgtataaaggcgatcaaggctgaacccaaaatccagccgttacgtattgat
gtcacccgtgcgggtgtcagggtgctgcgtggcggcacgcaagggcaagaactgggcgcg
cggactgtcgacctcaaaggcagctatgacctgccggacattatcggtgagttgcagcaa
ggtacgtctctcacgcgcaagacgctggtggatattctcatcggtagcggcaggttggac
gagttcattgccaatccgaacgactttatggcgatggttcgccgttgcgtagagggcgag
ctacagcgcgtcattgtagaaggcgttcagtatgaaaagatcggcggctccgtctatgaa
ctccgtgagttgcaagccgacggccttgctgaaaatgatttcttcaaagagcatctttac
cgcgttgaacaccccgagaaaactgactttgattatgtcgtgttcgatggcagaccggat
agcccggagcgaaagtttgccgagttcctcgaccaccgtgaggatatccggctgtttatg
aagctgccgccaagattccagatcgacacgccggttggcccctataacccggactgggct
atcatcaaatccgaagacggcgaagaccgtatctatatggttcgcgaaaccaagagcacc
atggatgaacaaaaaaggagaccttccgaaaatgccaaaatcaagtctgccgaggcacac
ttcagagaaattggcatcgagtatgcggtttcagtacctgaacagtggaatatctga

DBGET integrated database retrieval system