KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_0915Help
Entry
PC1_0915          CDS       T00934                                 

Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pct00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PC1_0915
Enzymes [BR:pct01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     PC1_0915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1060635..1062494
Genome map
AA seq 619 aa AA seqDB search
MIALLETALARRLLRPLDIQFARMLVDETQPDLLLAAACLSAHSGAGHVCLPLENLQAQT
LFDGRDPELAQQLLTEVGLNTVSAWQQRLLASDAVSDGTTSTPLVLQGEKLYLQRSWQSE
GRVARFIASERDTMSIDEPAIRSVLDRLFPDTGEAVDWQKVAAAVALTRRIAIISGGPGT
GKTTTVARLLAALIELNTGEALRIQLAAPTGKAAARLTESLGQALHRLSVEPQQREAFPQ
EATTLHRLLGAVTDSQRLRHHQDNPLHLDVLIVDEASMVDLPMMANVIAALPPHARIIFL
GDRDQLASVEAGAVLGDICRFAEAGYSRARAQQLQRLTGCKLDESGPEGQATVSDSICLL
RRSYRFDPHSGIGQLALAVNGGDDVRVRAVLNGEFADITCSPLAEAEEYQAMLAQCVEGY
RDYLQLIAAGASPDAVLLAFQRYRQLCALREGPFGVAGLNQRIEQALHQAGLIQRSRNPL
NRWYPGRPVMIERNDAALGLFNGDIGIAMTGESGELRVFFPLPNGETKDVTPSRLPPHET
AYAMTVHKSQGSEFDHTALVLPNHYLPVLTRELVYTAITRARQRLSLYTDIRILCRAVKT
PTQRYSGLEARISALMARS
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgattgccttacttgaaacggcactggcgcgacggctgctgcgcccgttggatattcag
tttgccagaatgctggtggatgagacgcagcccgatctgctgctagccgccgcttgtctt
agcgcgcattcgggcgcggggcatgtgtgtttaccgctggagaatttgcaggcacagacg
ctgtttgacggccgcgatcctgagttggcgcagcagctgcttacggaggtagggttaaac
acggtttctgcatggcaacagcgtttgttggcgtctgatgctgtcagcgacggcacgacg
tcaacgccgctggtgctgcaaggagaaaaactgtatttacagcgcagctggcagagtgag
ggacgtgtagcgcggtttatcgccagcgagcgcgatacgatgtcgattgatgaacctgcg
atccgatcggttctggatcggctgtttcctgacacgggcgaagcggttgactggcagaag
gtggccgctgctgtcgcattgacgcgccgcattgcgattatttccggcggaccggggacg
gggaaaaccacaacggtcgccaggctgttggcggcgctgattgagctgaatacgggagag
gcgttacgtattcaattagccgcgccgaccgggaaagcggctgcgcggctaacggagtcg
ctggggcaggctctgcaccgtctgtctgtcgagcctcaacagcgggaagcgtttccgcaa
gaggcgacgacgctgcatcgactgttgggcgcggtgacggatagtcagcgcctgcgtcac
catcaggacaatccgctgcatctggatgtgctgattgtggatgaggcgtcgatggtcgat
ctgccgatgatggcgaatgtgatcgctgcgcttccgccacacgccagaattatctttctt
ggcgatcgcgatcaactggcgtccgtcgaggcgggagcagtactgggggatatctgccgt
tttgccgaggcgggctatagccgcgcgcgggcgcagcaactgcagcggctgacgggctgt
aaattggatgaaagtggtcctgaaggacaggcgacggtcagtgacagtatctgtctgttg
cgccggagctaccgtttcgatccgcattccggtattggccaactggcgctggcagtgaac
ggcggcgatgatgttcgcgtgcgtgcggtgctgaacggtgagtttgctgatatcacctgt
agtccattagctgaggctgaagagtaccaggccatgctggcacagtgtgttgaagggtat
cgcgattatctgcaactgattgctgcgggagcctcgccggatgctgtgctgcttgccttc
cagcgctatcgccagctgtgcgcgctgcgcgaagggccgtttggtgtagcagggctgaat
cagcgcatcgagcaggctttgcatcaggctgggctaattcagcgcagtcgtaatccgctt
aaccgctggtatcccggccgcccagtcatgattgaacggaatgatgccgcattgggcctc
ttcaatggcgatattggtatcgccatgacgggggaaagcggtgaactacgcgtgtttttc
cccttgccgaatggcgaaaccaaagatgtcacaccaagccgtttgccgccgcacgaaacg
gcctatgcgatgacggtacataaatcgcaagggtcggagttcgatcataccgcgctggtg
ttgccgaaccactatttgccggtgctgacgcgggagttggtgtataccgccatcacccgt
gcacgccagcgtttatctctctataccgatatcaggatcctctgtcgtgcggtgaagacg
ccaacgcagcgctatagcggtttggaagcgcgaattagcgcgttaatggcacgttcttga

DBGET integrated database retrieval system