KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_1078Help
Entry
PC1_1078          CDS       T00934                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pct00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PC1_1078
DNA repair and recombination proteins [BR:pct03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      PC1_1078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1252122..1252727
Genome map
AA seq 201 aa AA seqDB search
MQTSPLLESLMEALRCLPGVGPKSAQRMAFQLLQRNRSGGMRLAQALTRAMSEIGHCSDC
RTFTEQDVCAICSNPRRQQNGQICVVESPADIHAIEQTGQFAGRYFVLMGHLSPLDGIGP
DDIGLGRLEERLQVESISEVILATNPTVEGDATANYIAELCAQHGVMASRIAHGVPVGGE
LEMVDGTTLSHSLAGRQPFRF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccagtccgcttcttgaatcattgatggaagcgctgcgctgcctgccgggcgtt
gggcccaaatcggcacagcgcatggcgtttcaattgctgcaacgtaaccgcagtggcggt
atgcgtttggcacaggcgttgacgcgggcgatgtccgaaatcggccactgtagcgattgc
cggacattcactgaacaggacgtttgtgcgatttgttcgaatccgcgccgccagcaaaat
gggcagatttgcgtggtggaaagcccggctgatattcatgctattgaacagacggggcag
tttgccggtcgttactttgtgttgatggggcatttgtcgccgctggatggcattggcccg
gatgatatcggtttggggcgcctggaagagcgcctgcaagtggaatcgataagcgaagtg
attctggcaaccaacccgacggtagaaggcgatgccacagcgaactatattgctgagctg
tgtgcgcaacacggcgtgatggctagccgcattgcccacggtgttcccgttggcggtgag
ctggaaatggtcgatggcaccacgctgtcccattcactcgcagggcgccagcctttccgg
ttttaa

DBGET integrated database retrieval system