KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_1122Help
Entry
PC1_1122          CDS       T00934                                 

Definition
Lysophospholipase (EC:3.1.1.5)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:pct00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    PC1_1122
Enzymes [BR:pct01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     PC1_1122
   3.1.2  Thioester hydrolases
    3.1.2.-  
     PC1_1122
Lipid biosynthesis proteins [BR:pct01004]
 Fatty acid synthase
  Component type
   PC1_1122
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1313364..1313957)
Genome map
AA seq 197 aa AA seqDB search
MLLGLCSVRAFAADTLLILGDSLSAGYQMPTANAWPTLLNTQWQTQKKGIAVVNASISGD
TTAQGLARLPALLKQHQPRWVLIELGGNDGLRGFPAPNIEQDLAKIITLVKQANAQPLIM
QIRLPTNYGRRYTESFSNIYPKLAEQFALPLLPFFMEQVYLKPEWMMEDGIHPTRDAQPF
IAEWMAKQLEPLVNHES
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
ttgcttctgggattatgcagcgtacgcgctttcgccgctgacacattattaattctgggc
gatagccttagcgcgggctaccaaatgccgaccgctaacgcgtggccaacgctgttgaac
acacagtggcaaacgcagaaaaaaggcatcgctgtggttaacgccagcattagcggtgac
accaccgcacaagggctggcgcgacttcctgccttgttaaaacagcatcagccacgttgg
gtgttgattgaactgggcggcaatgacgggctacggggatttccggcccctaatatcgag
caggatctggcaaaaatcatcacgctggtcaaacaggctaacgctcagcctctgattatg
cagatccgtttgccgaccaactatggccgtcgctacaccgagtcattcagcaatatttac
cccaaattggcggagcagtttgcacttccgctgctgcctttctttatggagcaggtgtat
cttaaaccggagtggatgatggaagatggcatccatccaacccgggatgcccaaccgttt
atcgcagaatggatggcgaagcagctggaacccttagttaaccatgagtcttaa

DBGET integrated database retrieval system