KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_1238Help
Entry
PC1_1238          CDS       T00934                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pct00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PC1_1238
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PC1_1238
   00640 Propanoate metabolism
    PC1_1238
   00660 C5-Branched dibasic acid metabolism
    PC1_1238
Enzymes [BR:pct01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     PC1_1238
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1446831..1447997
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFARYGLPAPTGYACTTPREAEEAASKIGAGPWVVKCQVHAGGRGKAGGV
KVVSNKEDIRAFAENWLGKKLVTYQTDAQGQPVHQILVEAATDIDKELYLGAVVDRGTRR
VVFMASTEGGVEIEKVAEETPELIHKAAIDPLVGPQPYQGRELAFKLGLSGKQVAQFTKI
FMGLATLFLERDLALVEINPLVITKQGDLVCLDGKLGADGNALFRQPELREMRDPSQEDS
REAHAAQWELNYVALDGNIGCMVNGAGLAMGTMDIVKLHGGSPANFLDVGGGATKERVTE
AFKIILSDDKVKAVFVNIFGGIVRCDLIADGIIGAVAEVGVNVPVVVRLEGNNAELGAKK
LADSGLNIIAATSLTGAAQQVVAAVEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacacgagtatcaggcaaaacaactctttgctcgatatggtttaccggcaccg
accggctatgcctgtaccacaccgcgtgaagcggaagaagccgcgtctaaaattggtgcg
ggtccgtgggtcgtaaaatgtcaggttcacgcaggcggtcgcggtaaagcgggcggcgtt
aaagtcgtcagtaacaaagaagatatccgcgcctttgctgaaaactggttaggtaaaaaa
ctcgttacttatcaaactgacgcacagggccaaccggttcatcaaatcctggttgaagcg
gcaacagatatcgacaaagagctttatctgggcgcagttgttgaccgtggcacgcgtcgc
gtggtgttcatggcatccaccgaaggtggtgtagaaattgaaaaagtggcggaagagacg
ccagaactgattcataaagcagcgatcgatccgctggtagggccacagccttatcaggga
cgcgagttggccttcaaactgggcctgagcggcaagcaagtggcacagttcaccaaaatc
tttatgggtctggcgacgctgttcctggagcgcgatctggcgctggtagaaattaacccg
ctggttatcaccaagcagggcgatttggtgtgtctggatggcaaactcggcgcggacggc
aatgcgctgttccgccagcctgagctgcgcgaaatgcgtgacccaagtcaggaagattcc
cgtgaagcacatgcggcacagtgggaactgaactatgttgcgctggacggcaatattggc
tgtatggtgaacggtgctggcctggcgatgggcacgatggacatcgtgaagctgcacggc
ggttctcctgcaaacttcctcgacgttggcggcggcgcgacgaaagaacgtgttaccgaa
gcgttcaaaattatcctgtctgatgacaaggtaaaagctgtctttgttaacatctttggc
ggcattgtacgttgcgatttgatcgctgacggcatcatcggcgcggtagccgaagtgggt
gttaacgtaccggttgttgtgcgtttggaaggaaacaatgcggagctgggtgccaagaaa
ctggcggatagcggcctgaatattatcgccgcgaccagcctgacgggtgccgctcagcag
gttgttgcagctgtggagggtaaataa

DBGET integrated database retrieval system