KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_1258Help
Entry
PC1_1258          CDS       T00934                                 

Definition
phosphoglycerate mutase 1 family (EC:5.4.2.4)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pct00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PC1_1258
   01230 Biosynthesis of amino acids
    PC1_1258
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PC1_1258
  Energy metabolism
   00680 Methane metabolism
    PC1_1258
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PC1_1258
Enzymes [BR:pct01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     PC1_1258
Exosome [BR:pct04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   PC1_1258
  Exosomal proteins of melanoma cells
   PC1_1258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1466197..1466949)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNNENRFTGWYDVDLSDKGRSEAKAAGQLLKDEGFAFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
ITPPELTRDDERFPGHDPRYASLSDKELPLTESLALTIERVVPYWNETILPRIKSGERVI
IAAHGNSLRALVKYLDNMGEDEILELNIPTGVPLVYEFDENFKPIKRYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggtactggtaagacacggtgagagccagtggaacaacgaaaac
cgcttcacgggctggtacgatgtcgatctgtccgacaaaggccgttcagaagccaaagcc
gcaggtcagctgctgaaagacgaaggttttgcctttgatttcgcgtatacctccgtgctg
aaacgtgccattcacacactgtggaacgtactggacgagctggatcaagcctggttgcca
gttgaaaaatcctggaaactgaacgagcgccactacggtgcgctgcagggtctgaacaaa
gccgaaaccgctgagaaatacggtgacgagcaggttaaacaatggcgtcgtggtttcgca
attacgcctccagagttgacgcgtgatgacgaacgtttccctggccacgatccgcgttac
gcttctctgagcgacaaagagctgccgctgactgaaagcctggcgctgaccatcgaacgt
gttgtgccttactggaatgaaaccatcctgccacgcatcaagagcggcgagcgcgttatc
atcgcggctcacggtaactcactgcgtgcactggtgaaatacctggacaacatgggcgaa
gacgaaattctggaactgaatatcccaactggcgtgccgttggtttatgagttcgacgag
aacttcaagccaatcaaacgttactacctgggcaacgcagacgaaatcgctgcaaaagct
gctgcagtagcaaatcagggtaaagcgaagtaa

DBGET integrated database retrieval system