KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_1327Help
Entry
PC1_1327          CDS       T00934                                 

Definition
family 1 glycoside hydrolase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pct00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1545545..1546969
Genome map
AA seq 474 aa AA seqDB search
MKYRHLKRFPEGFLWGAATSAYQVEGAWNEDGKGPSVIDARTSYPEGTTDFKVASDHYHR
YKEDVALFADIGFKTYRFSIAWSRIIPDGSGEVNPAGIAFYHNLIDELLHYGIVPIVTMY
HFDLPQALQAKGGWYSRETVDAFERFANVLFDEYGEKVQYWLTINEQNMMILHGSALGTL
DPTLENPKQNLYQQNHNMLVAQAKAMNALHEKVPGAKIGPAPNIALIYPASAKPEDVMAA
FNYNAIRNWLYLDMAVHGRYNTAAWRYMEEKGYTPEILPGDMDILASAKPDFIAFNYYTS
QTVEASKGDGSDEIARGGDQHLKSGEEGVHRGATNPFLQKNAFGWEIDPIGFRNTLRELH
DRYHLPLIITENGLGAFDTLDENGEVNDDYRIDYLQRHIEQIQLAITDGVDVFGYTPWSA
LDLISTHQGCSKRYGFIYVNREEFDLKDLRRIRKKSAYWYANVIKNNGLGSSEA
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
gtgaaataccgtcatcttaaacgtttccctgaggggtttttgtggggcgcggcgacatcg
gcttatcaggttgaaggggcatggaatgaggatggcaaggggccatcggtgattgatgcc
agaacgtcctatcctgagggcaccacggactttaaagtcgccagcgatcattaccaccgc
tacaaggaagatgtggcgctgtttgccgatatcggctttaaaacctaccgtttttccatc
gcctggagccgcatcattcccgatggcagcggtgaggtaaacccggcgggcattgcgttt
taccacaatcttatcgatgaactgctgcattacggtattgtgccgatcgttacgatgtac
catttcgatctgccgcaggcgttgcaggccaaaggcgggtggtacagccgggaaacggtg
gatgcgtttgaacgttttgccaacgtactgtttgatgaatacggcgaaaaagtgcagtac
tggctgaccatcaacgaacagaacatgatgattttgcacggttccgcactgggtacgttg
gatcccacgctggaaaatccgaagcagaatctctaccaacagaaccacaacatgctggtg
gcacaggcaaaagcgatgaatgcgctacatgaaaaagtgcccggcgcgaaaattggtccg
gcacccaacattgcgctgatttacccggcatcagcgaagcctgaagatgtgatggccgcg
ttcaactataacgcgattcgcaattggttatatctggatatggcggtgcacggccgttac
aacacggcggcatggcgctatatggaagagaaaggctatacgccggagattctgcccggc
gatatggacattctggcatcggccaaacccgatttcatcgcgtttaactactacacctcg
caaacggttgaagccagcaagggcgacggatcggatgaaattgcacgtggtggcgatcag
cacctgaaatcaggtgaagaaggcgtacatcgtggcgcaaccaatccatttttgcagaaa
aatgcctttggctgggaaatcgatcccatcggtttccgcaatacgctgcgtgagctgcac
gaccgctaccatttaccgctgatcattacggagaatgggctgggcgcgtttgatacgctg
gatgaaaacggtgaggttaacgatgattatcgcatcgactacctgcaacgccacattgag
caaatccagcttgcgatcactgacggtgtggatgtcttcggctatacgccatggtcggcg
ttggatctcatttccacccatcagggatgctcaaaacgctacggttttatttacgtgaac
cgtgaagagttcgatctgaaagatttgcggcgtatccgtaaaaaaagcgcatactggtat
gctaatgtcattaaaaacaatgggctgggtagctcagaagcgtaa

DBGET integrated database retrieval system