KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_1362Help
Entry
PC1_1362          CDS       T00934                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pct00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    PC1_1362
  Lipid metabolism
   00600 Sphingolipid metabolism
    PC1_1362
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    PC1_1362
Enzymes [BR:pct01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     PC1_1362
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1585233..1588364)
Genome map
AA seq 1043 aa AA seqDB search
MSDTVLPHPVRHRATLQEILSRRDWENPTCTHYQRLPAHPPFNSWRSVATAQQDEPSQRL
RRLNGEWTFSYFTRPEAVPESWLQQDLPDADTIPVPSNWQLQGYDAPIYTNVKYPIPVTP
PYVQKDNPTGCYSLTFKINHDWISNGQTRIIFDGVNSAFYLWCNGHWVGYSQDSRLPAEF
DIGRYLTTGENRLAVMVLRWSDGSYLEDQDMWRMSGIFRDVTLLHKPTVHLRDIQLTTPL
SADFRHGTLEIQVRATLTEAESKSHRVRAQLWRGNKLIGDTRQAFGSDIVDERGAYHDKA
FLRIDVPQPDLWSAELPHLYRTVISLETAEGELVEAEAYDVGFRKVEIRNGLLLLNGQPL
LIRGVNRHEHHPQHGQVMDEDTMRRDIMLMKQHNFNAVRCSHYPNHPLWYRLCDRYGLYV
VDEANIETHGMQPMNRLSDDPVWLPAYSERVSRMVQRDRNHPCIIIWSLGNESGYGANHD
ALYQWIKRHDPTRPVHYEGGGANSRATDIVCPMYARVDEDQPFPSVPKWSITKWISMPDE
HRPLILCEYAHAMGNSLGGFARYWQAFRQYPRLQGGFIWDWVDQALTRHDEQGNAYWAYG
GDFGDTPNDRQFCLDGLLFPDRTPHPSLYEAQRAQQHIQFDWQAESPCELHVTSEYLFRH
TDNEQLNWRITLDDKMLAEGSLPLSLAPQSTQTLTLLEALPAVEHTGELWLNVEVVQPKA
TAWSEANHRCAWDQWQLPAPLHLPDTASSGQKQRPVLRSSDEHFDIVQGEQRWHFNRQSG
WLEQWWTADTPALLTPLQDQFVRAPLDNDIGISEVDRIDPHAWAERWKSAGLYQLQTQCI
AIQADQLDDAVQVTTEHVFRHAGQILLRSKKRWQIDVHGVMTVDVDVDVATVLPSLARVG
LSCQLADVAPQVSWAGLGPHENYPDRQLAAQHGHWSLPLDDLHTPYIFPSENGLRCNTRT
LTYGKWTITGNFHFGLSRYGLTQLMTCTHHHLLEKEEGVWLNLDGFHMGIGGDDSWSPSV
HRDDLLTATHYHYRVALQHHQPY
NT seq 3132 nt NT seq  +upstreamnt  +downstreamnt
atgagcgataccgttttgccgcatcccgtacgccatcgcgccacgctgcaagaaatcctt
tcccgacgcgattgggaaaacccaacctgtactcactaccagaggcttcctgcacatccg
ccgtttaacagctggcgcagcgtagctaccgcacagcaggatgaaccttctcagcggctg
cgtcgcctcaatggcgaatggacgtttagctatttcactcgcccggaagcggtgccggaa
agctggttacagcaggatctgcccgatgccgataccatcccagtgccttccaattggcaa
ttacagggctatgacgctccgatttataccaacgtaaaatacccgatccccgtcacccca
ccttatgtgcagaaagacaatcccaccggttgttactcgctcacttttaagatcaatcat
gactggatcagcaacgggcaaacccggattatctttgacggtgttaactccgcgttttac
ctctggtgtaacggtcactgggtaggatattcgcaggatagtcgcctgcctgcggagttt
gatatcgggcgctatctgacaaccggagagaatcggctggccgtcatggtgttacgctgg
tctgacggcagctatctggaagatcaggatatgtggcgtatgagcggtattttccgcgat
gtcacgcttctgcataaacccacggttcacctcagagatatccaactgactacgccgctc
agcgccgatttccgccacggcacactggagattcaagtgagggcaacgctcaccgaagcg
gaatccaaaagccatcgtgtccgtgcacagctttggcgtggtaataaactcatcggtgac
acacgacaggcattcggcagcgatattgtcgatgaacgcggtgcttaccacgataaggct
tttctccgtattgacgtgccacagcccgatctgtggagcgccgaactgccgcacctgtat
cgcacagttatttcattggaaacagcagaaggcgagctcgtagaagcagaagcctatgat
gtcggtttcagaaaagttgaaatccgcaacggtctgctgctgctgaacggtcaaccgcta
ctgattcgtggcgttaaccgccatgagcatcatcctcagcatggtcaggtcatggatgaa
gacacgatgcggcgcgatattatgctaatgaaacagcataattttaacgccgtgcgttgc
tcacattaccccaaccatccgctgtggtatcggctgtgcgatcgttacggcctgtatgtt
gtggatgaggcgaacattgagacgcacggcatgcagccaatgaatcgtctgtcagacgat
cccgtctggctaccggcctacagcgaacgcgtgtcgaggatggtacaacgcgaccgcaat
catccctgcattattatctggtcattggggaacgagtccggttacggcgcaaatcatgac
gcactctatcagtggatcaagcgccacgatccgacgcgtcccgtgcattacgaaggcggc
ggcgcgaacagtcgtgcgaccgacattgtgtgccccatgtacgcccgcgtcgatgaagat
cagcccttccccagcgtgcccaaatggtcgatcaccaaatggatcagcatgccggacgaa
catcggccacttatcctctgcgagtacgcacacgcgatgggtaacagtctggggggattt
gctcgctactggcaggcattccgtcaataccctcggttacagggcggattcatctgggac
tgggtcgatcaggcactgacccgccacgacgagcaaggcaatgcctactgggcatacggt
ggagactttggcgacacacctaacgatcgtcagttctgtctggacggcttgctgtttccc
gatcgcaccccgcatcccagcctgtatgaagcccagcgggcacagcagcatattcagttc
gactggcaggcggagtcaccgtgtgagcttcacgtcaccagcgaatacctgtttcgccat
acggacaatgagcagttgaactggcgcatcacgctggacgataaaatgctcgcagaaggt
tcgctgccgctgtctctcgctccgcagtccacccagaccctcacgctactggaggcgctt
cccgccgtcgaacacacaggggagctttggctcaatgttgaagtcgtacagcctaaagcc
accgcctggtcagaggcaaaccaccgctgcgcctgggatcaatggcaactccctgcgcca
cttcatcttcccgatacggccagttccgggcagaagcaacgccccgtactgcgatcgtct
gatgagcacttcgatatcgttcagggcgaacaacgctggcactttaaccgccagagcggc
tggctggaacagtggtggacagccgacacgccagcgctgttaacccctttgcaagatcag
tttgttcgggcaccgctggataacgacatcggtatcagcgaagttgatcgcatcgatccg
cacgcttgggccgaacgttggaaatcagccggtctttatcaattgcagacgcagtgtata
gcgattcaagctgaccaactcgacgatgcggtgcaggttactaccgagcacgtattccgc
catgccggacaaatcttgctacggagtaaaaagcgctggcagattgatgtacacggcgta
atgactgttgatgtcgacgttgatgtcgcgacggtactcccatcattagccagagtgggc
ttgagctgccagctagccgacgtggcacctcaggtcagttgggccgggcttgggccacat
gagaattacccagaccgacagttggctgcacagcatggacactggagtctgccgctggat
gaccttcatacgccctacattttcccgtcagaaaacggactgcgctgcaacactcgcacg
ctaacgtacggcaaatggacaatcaccggaaatttccacttcgggttaagtcgttatggg
ttaacacagttaatgacctgtactcaccaccatttattagaaaaggaagaaggtgtttgg
ctcaatctggatggcttccatatgggcattggcggcgatgattcctggagtcccagcgtt
catcgcgatgatttactcacggcgacacattatcactaccgcgtcgcgcttcaacatcac
caaccgtattga

DBGET integrated database retrieval system