KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_1404Help
Entry
PC1_1404          CDS       T00934                                 

Definition
pyridoxal phosphate-dependent enzyme, D-cysteine desulfhydrase family (EC:3.5.99.7)
Orthology
K17950  
L-cysteate sulfo-lyase [EC:4.4.1.25]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:pct00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    PC1_1404
Enzymes [BR:pct01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.25  L-cysteate sulfo-lyase
     PC1_1404
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1639805..1640818
Genome map
AA seq 337 aa AA seqDB search
MHLARFPRLSLGHFPTPLEVLPNLSAYLGGPTIYIKRDDATGLATGGNKTRKLEFLLADA
QQQGADIIITQGATQSNHVRQTIAAATKLGLKTKVLLEKRVEDYGEDYQRSGNVLLDHLL
GGEIIDHLPAGTDMQQAMETLAESLRKEGLKPYVIPGGGSSPVGALGYVACAEELLFQSS
QQRLRIDHIVHATGSTGTQAGLVTGLAATHSQIPLLGISVRAPKAKQEENVYALAQRTWQ
LLGIPGELPRSAVQVNSDYVGKGYGIPTEGTLEALRLLAQLEGILLDPVYSGKGMAGLID
LIRQGHFHADENIVFIHTGGSAGLFGYRQLFEQTAAQ
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgcaccttgcccgattcccccgtttgtcactgggccattttcctacaccgctggaggta
ttgccgaatctgtctgcctatctgggcgggccgacgatttatatcaaacgcgacgatgcg
acaggactggcaacgggtgggaataaaacccgcaaactggaattcctgttagccgatgcg
caacagcagggcgcggatatcattatcacgcagggcgcgacgcagtctaaccatgtacgg
caaaccattgcggcggcgacaaagctggggctgaaaaccaaagtactgctggaaaagcgc
gtggaggactacggcgaagactaccagcgttccggcaacgtgctgctggatcatctgctt
ggcggtgaaattatcgatcatctgcccgctggaacggacatgcagcaggcgatggaaacg
ctggcagaatcgctgcgcaaagaaggattgaaaccttatgtcattcccggcggcggctcc
agtccggtaggcgcactaggctatgtcgcctgtgcggaagagttgctgtttcagtctagc
cagcagcgcctgcgcatcgatcatattgtgcatgcgacggggagcacgggtacgcaggcg
ggattggttaccgggctggcggcgacgcatagccaaattcccttgttaggcatcagcgtc
agagcgccgaaagcgaagcaggaagagaatgtttacgcattagcgcagcgcacctggcaa
ctgctcggtattccgggtgagctgccgcgcagtgctgtgcaggtgaacagtgactacgtt
ggcaaagggtacggtattccaaccgaaggaacgctggaagcactcaggctgctggcacaa
ctggaagggattctgctcgatccggtctattccggtaaaggcatggcggggctgatcgac
ctgattcgtcagggacattttcacgccgatgaaaacattgtcttcatccatactggtggg
tcagccggactgtttggttaccgtcaactgtttgaacagacggccgcacaatga

DBGET integrated database retrieval system