KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_1461Help
Entry
PC1_1461          CDS       T00934                                 

Definition
family 1 glycoside hydrolase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:pct00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PC1_1461
Enzymes [BR:pct01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     PC1_1461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1710820..1712256
Genome map
AA seq 478 aa AA seqDB search
MSERFPHGFMWGGATAANQVEGAYNIDGKGLSIVDAIPGGKARLSIVASDAFDFTLDEQR
YTYPNHKGIDHYHRFREDIALFAEMGFKCYRFSIAWTRIYPNGIEQQPNEAGLSHYEQVI
DTCIAHGIEPVITISHYEMPLHLATAFGGWKNRELISHFERFARTVLERFGHKVKYWMTF
NEINSAAHFPIMSQGLTVQTGALEPQAKFQAWHNQFVASSLAVKIAHETNPQIQIGCMIL
FATNYAYDCNPVNQLATLKETQAFNFYCADVQAGGKYPYYAKSLWQSLGVTLDIQPGDLE
LIKQHTVDYIGFSYYMSSTIYKTDPDAAAAHGNLLGGARNPFLEASEWGWEIDPVGLRIA
LNQLYDRYEKPLFIVENGLGAVDKPNEERYIADDYRINYLRQHIEAMADAIADGVELMGY
TPWGCIDLVSMSTGEMSKRYGFIYVDLDDTIAGSGNRYKKKSFHWYQKVIATNGSDIS
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaagatttccgcacggctttatgtggggcggcgccaccgcagcgaatcaggtc
gaaggggcctacaatatcgacggcaaagggttgtcgattgtggatgccattcccggcggt
aaagcgcgtttaagcatcgtggcttccgacgcgtttgatttcacgctggatgaacagcgc
tacacctatcctaatcataaaggcatcgatcactatcatcgcttccgcgaggatatcgcg
ctgttcgccgagatgggtttcaaatgctatcgcttctccattgcctggacgcgcatttac
ccgaacggcattgagcaacagcccaacgaagcggggctaagccactatgaacaggtgatt
gatacctgcatcgctcatggtatcgagcccgtgattacgatctctcactatgaaatgccg
ctgcatcttgccaccgcctttggcggctggaaaaaccgtgagctaatcagtcattttgag
cgctttgcccgcacggtgctggagcgctttggccacaaagtgaaatactggatgaccttt
aacgagatcaacagtgctgcccatttcccgattatgagtcagggactgacggtgcaaact
ggcgcactggagccacaggctaaatttcaggcgtggcataaccagtttgttgccagcagc
ctggcggtgaagattgcgcatgagacgaatccgcagatccagattggctgtatgattctg
tttgccacgaattacgcctatgactgtaatcccgtcaatcaactggcgacgctgaaagag
actcaggcctttaatttctactgtgcggacgtgcaggcgggcgggaaatatccttactac
gcgaaaagcctgtggcagtcgctgggcgtcacgctggatattcagccgggcgatctggaa
ctgattaaacagcacaccgtcgattacatcggcttcagttattacatgtcttccactatc
tataaaacggatcccgatgcagcggcggcgcacggcaacctgctgggcggagcgcgtaat
ccgtttctggaagccagcgagtggggttgggaaattgacccggtggggctgcgcattgcg
ctcaatcaactgtatgaccgctacgagaaaccgctgtttatcgtcgaaaacggcttgggt
gcggtggataagccgaatgaagagcgctacatcgccgatgactaccgcatcaactacctg
cgtcagcacatcgaagcgatggccgacgcgattgccgacggtgtcgaactgatgggatat
accccgtggggctgtatcgatctggtcagcatgtctaccggtgagatgagcaaacgttac
ggctttatctatgtcgatctggatgacacgatcgccggcagcggcaaccgctataagaag
aaatcgttccactggtatcaaaaagtcattgccactaacggcagtgatatcagctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system