KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_1670Help
Entry
PC1_1670          CDS       T00934                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pct00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PC1_1670
Enzymes [BR:pct01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     PC1_1670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1925068..1925730
Genome map
AA seq 220 aa AA seqDB search
MSSLSKEAVMVHEALLARGLETPLRGALLDRDTRKQRIAEHMTEIMNLLSLDLSDDSLAE
TPTRIAKMYVDEIFSGLDYANFPKITIIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKA
TVAYIPKDGVIGLSKLNRIVQFFSQRPQVQERLTQQILVALQTLLGTNNVAVSIDAVHYC
VKARGIRDATSATTTTSLGGLFKSSQNTRQEFLRAVRHHN
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcactaagtaaagaagccgttatggtgcacgaagcgctgctggcacgcggtctg
gaaacgccgctgcgcggagcgttgttagatcgagatacgcgtaagcaacgtattgccgag
catatgacggaaattatgaatttgctgagccttgacctgagcgatgacagtctggctgaa
acaccgacgcgtatcgccaaaatgtacgttgatgaaatattctccggtttggactacgcc
aatttccccaaaatcaccatcattgaaaacaaaatgaaggttgatgaaatggtcaccgtg
cgtgatatcacgctgaccagcacctgcgaacaccatttcgtgacgatcgatgggaaagca
acggtggcgtatattccgaaagatggcgtcatcggtttgtcgaagctcaaccgaatcgtc
cagtttttctctcagcgccctcaggtgcaggagcgcttgacgcagcagattctcgtcgcg
ctacaaacgctcttgggcacgaataacgtcgcggtttcgattgatgcggtgcattactgc
gtgaaagcccgcggtattcgcgatgcaaccagcgccacgaccacgacatcgctcggcgga
ttgtttaaatccagccagaacacgcgtcaggaattcttgcgcgcggtgcgtcatcataat
taa

DBGET integrated database retrieval system