KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_1744Help
Entry
PC1_1744          CDS       T00934                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
pct00340  Histidine metabolism
pct01100  Metabolic pathways
pct01110  Biosynthesis of secondary metabolites
pct01230  Biosynthesis of amino acids
Module
pct_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:pct00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    PC1_1744
Enzymes [BR:pct01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     PC1_1744
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ACT12785
JGI: PC1_1744
UniProt: C6DF76
Position
complement(2014793..2016121)
Genome map
AA seq 442 aa AA seqDB search
MADNTNSTGSFSTLVDWQRCSAEEQRQLLTRPAISASDRITAIVSDILTNVKSRGDNALR
DYSAQFDKVQVDAIRVTDAEIVAAAARLGDDVKQAMAIAVRNIETFHNAQKLPTVDIETQ
PGVRCQQLTRPIATVGLYIPGGSAPLPSTVLMLGTPSRIAGCGRVVLCSPPPIADEILYA
AQLCGIKEVFQLGGAQAIAAMAFGTESVPKVDKIFGPGNAYVTEAKRQVSQQLDGAAIDM
PAGPSEVLVIADSGATPAFVASDLLSQAEHGPDSQVILLTPDAAMAKAVADAVEEQLTQL
SRADIARQALASSRVIVARDLAQCVEISNQYGPEHLIIQTRDAESLVDSITSAGSVFLGD
WSPESAGDYASGTNHVLPTYGYTSTYSSLGLADFQKRMTVQQLTPQGLLQLAPTIETLAQ
AEQLTAHKNAVTLRVAALKEQA
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggctgataacaccaacagcaccggcagtttcagcacgctcgtcgactggcagcgctgc
tcagcagaagagcagcgtcagctactgactcgcccggccatttccgcgtcagaccgcatt
accgccatcgtaagcgacattctgacaaacgtaaaaagccgtggcgataacgccctgcgc
gactacagcgcccaatttgacaaagttcaggtggatgcgattcgcgtcaccgatgccgag
atcgtcgcagccgcggcgcgtctgggtgatgacgtcaaacaggcgatggcgatcgccgtg
cgtaatatcgaaacattccacaacgcgcaaaagctgccgactgtcgatatcgaaacgcag
ccgggcgtgcgttgccagcagctcactcgccctatcgcgaccgtcggactgtatatccct
ggcggttccgccccactgccgtcaaccgtgttgatgctgggaacgccttcgcgcatcgcc
ggctgcggtcgcgtggtgctgtgctcaccgccgccgattgccgatgaaattctgtatgcc
gcccagctgtgcggcattaaagaagtctttcagctcggtggcgcgcaagcgattgctgcg
atggcgtttggcacagagagcgtaccgaaagtagacaaaatttttggccctggcaatgcg
tacgtcacggaagccaagcgtcaggttagccagcagcttgatggcgcagccattgatatg
cccgccggcccttccgaagtgctggtgatcgccgacagcggcgcaacgcccgcgtttgtt
gcctccgacctgctgtcgcaggcagagcacggcccagattcacaggtcattctgctcacg
ccagacgcggcaatggccaaagccgtggcggacgccgttgaagaacagctcacgcaactg
tcccgtgcagacatcgcgcgtcaggcacttgccagcagccgcgtcatcgtcgcacgtgat
ttggcgcagtgcgttgagatcagcaatcaatatggcccagagcacctgatcatccagacg
cgcgatgccgaatcactggttgatagcatcaccagcgccggttccgtgttcctcggcgac
tggtcgccggagtccgctggcgactacgcctccggtactaaccacgttctgccgacctat
ggttatacctcaacctattcaagcctgggtctggccgatttccagaagcgcatgaccgta
cagcagctcacgccgcaggggttactgcaactggcaccaacgatagaaaccttggcacag
gccgaacagctaactgcccacaaaaacgccgttaccctgcgtgtcgcagcactgaaggag
caagcatga

DBGET integrated database retrieval system