KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_1819Help
Entry
PC1_1819          CDS       T00934                                 

Definition
(GenBank) Holliday junction DNA helicase RuvA
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
pct03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:pct00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PC1_1819
Enzymes [BR:pct01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     PC1_1819
DNA repair and recombination proteins [BR:pct03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     PC1_1819
    RecFOR pathway proteins
     PC1_1819
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvA_N HHH_5 RuvA_C HHH IMS_HHH HHH_2 Transposase_20 HHH_8
Motif
Other DBs
NCBI-ProteinID: ACT12860
JGI: PC1_1819
UniProt: C6DFF1
Position
2104157..2104774
Genome map
AA seq 205 aa AA seqDB search
MIGRLRGIILEKQPPQVLIEANGVGYEVHMPMTCFYELPELNQEAIIFTHFVVREDAQLL
FGFNDKQERALFRELIKVNGVGPKLALAILSGMSATQFVSAVEREEIGALIKLPGVGKKT
AERLVVEMKDRFKGLSGDLFNPVSDIPLASPASAESRASDPEAEAAAALVALGYKPQEAS
RMISKIARPEADCETLIRDALRAAL
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
gtgataggtcgtctcagaggcattatcctggaaaaacagccgccgcaggtgctgatagaa
gctaacggcgtgggttacgaagtccatatgccgatgacgtgcttttacgaactccctgag
ctcaatcaggaagcgattatctttacccatttcgtggtccgcgaagatgcacaactgctg
ttcggttttaatgataagcaggagagggcgctgttccgcgagctgatcaaagtgaatggc
gttgggccgaagctggcgctggcgattctatccgggatgtccgcgacgcagtttgtcagc
gcggttgagcgcgaagaaatcggtgcgttgattaaacttccgggcgtaggtaagaaaacg
gcggaaaggctggttgttgaaatgaaagatcgcttcaagggcttgagcggcgatctgttt
aatccggtcagcgatattccgctggcatcgccggctagcgcagaaagccgtgccagcgat
cctgaagcggaagccgcagcagcactggttgcgctgggctataaaccgcaggaagctagc
cgcatgatttccaagattgcgcgccctgaggccgactgtgaaaccctgatcagggatgca
ctgcgcgcggcgctgtga

DBGET integrated database retrieval system