KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_1819Help
Entry
PC1_1819          CDS       T00934                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:pct03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2104157..2104774
Genome map
AA seq 205 aa AA seqDB search
MIGRLRGIILEKQPPQVLIEANGVGYEVHMPMTCFYELPELNQEAIIFTHFVVREDAQLL
FGFNDKQERALFRELIKVNGVGPKLALAILSGMSATQFVSAVEREEIGALIKLPGVGKKT
AERLVVEMKDRFKGLSGDLFNPVSDIPLASPASAESRASDPEAEAAAALVALGYKPQEAS
RMISKIARPEADCETLIRDALRAAL
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
gtgataggtcgtctcagaggcattatcctggaaaaacagccgccgcaggtgctgatagaa
gctaacggcgtgggttacgaagtccatatgccgatgacgtgcttttacgaactccctgag
ctcaatcaggaagcgattatctttacccatttcgtggtccgcgaagatgcacaactgctg
ttcggttttaatgataagcaggagagggcgctgttccgcgagctgatcaaagtgaatggc
gttgggccgaagctggcgctggcgattctatccgggatgtccgcgacgcagtttgtcagc
gcggttgagcgcgaagaaatcggtgcgttgattaaacttccgggcgtaggtaagaaaacg
gcggaaaggctggttgttgaaatgaaagatcgcttcaagggcttgagcggcgatctgttt
aatccggtcagcgatattccgctggcatcgccggctagcgcagaaagccgtgccagcgat
cctgaagcggaagccgcagcagcactggttgcgctgggctataaaccgcaggaagctagc
cgcatgatttccaagattgcgcgccctgaggccgactgtgaaaccctgatcagggatgca
ctgcgcgcggcgctgtga

DBGET integrated database retrieval system