KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_1956Help
Entry
PC1_1956          CDS       T00934                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pct00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PC1_1956
   01230 Biosynthesis of amino acids
    PC1_1956
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PC1_1956
   00030 Pentose phosphate pathway
    PC1_1956
   00051 Fructose and mannose metabolism
    PC1_1956
   00052 Galactose metabolism
    PC1_1956
  Energy metabolism
   00680 Methane metabolism
    PC1_1956
Enzymes [BR:pct01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PC1_1956
Protein phosphatases and associated proteins [BR:pct01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PC1_1956
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2246951..2247931)
Genome map
AA seq 326 aa AA seqDB search
MKIGLVISGGDVSGINNFIFQVNRMTDADIVIFDGGINGLIDNCCKAITRRDLVDYSISS
MPLMTSGRRAGKCRKADYEKIVKNIQKQKLDALIMAGGDGSFQFLKKLSHYGVHCYGVGM
TIDNDISGNSYTIGFSTACEQVMSEVEKLRNTGRGLQGRVFMIELLGGYCGELTLQAALK
SNADIALIPESPWDMDTLSQCIREKIAEQNSVIILCSEGYTQEYTPGFQGAIDTIIKKLE
HKIGIRIRKTILGYGLRNGAPTGEEIIQGTLLAEEVVRCINTGLTNKIIIINNNNKAIPI
DLEESECRLVDVESHFYKLAKAHHLI
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattggattagtcattagtggcggcgatgttagcggaataaataacttcatcttt
caggtgaacagaatgacagatgctgacatcgttatttttgatggtggaattaatggcctt
atcgacaattgctgcaaagcgattactcgccgcgatctggttgattattccatctcatca
atgccgttgatgacgtcagggagaagagcaggaaaatgcagaaaagctgattatgagaaa
atcgttaaaaatatacaaaaacaaaaactcgatgcgctcatcatggctgggggtgatgga
tcattccaatttctcaagaagctcagccactatggtgtccattgctacggcgtaggaatg
acgattgacaatgatatttcaggaaacagctacacgattggtttttctaccgcctgcgaa
caggtaatgagtgaggtagaaaagttacgcaatacgggccggggattacaaggccgagta
ttcatgattgaactgctgggcggttattgtggggaattaacattacaggccgcattaaaa
agcaatgctgatattgcgcttattccagagtcaccctgggacatggatacgttatcacaa
tgtattcgggaaaagattgcagaacagaatagcgtgattattttatgctctgaaggttat
acccaggaatatacacccggctttcagggcgcgatcgacaccattatcaagaagctagag
cacaaaattggaatccgtatccgaaagactattttgggatatggtttacgaaatggcgcg
cccaccggggaagaaattattcagggcacccttttagcagaggaagtcgttcggtgtatc
aacactgggctgacaaataaaatcattattattaataacaacaacaaagctattcccatc
gacctagaggagtccgaatgccgcttagtcgatgtagaaagtcatttttataagctcgcg
aaagctcatcatcttatatga

DBGET integrated database retrieval system