KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_1956Help
Entry
PC1_1956          CDS       T00934                                 

Definition
(GenBank) phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
pct00010  Glycolysis / Gluconeogenesis
pct00030  Pentose phosphate pathway
pct00051  Fructose and mannose metabolism
pct00052  Galactose metabolism
pct00680  Methane metabolism
pct01100  Metabolic pathways
pct01110  Biosynthesis of secondary metabolites
pct01120  Microbial metabolism in diverse environments
pct01130  Biosynthesis of antibiotics
pct01200  Carbon metabolism
pct01230  Biosynthesis of amino acids
pct03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:pct00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PC1_1956
   00030 Pentose phosphate pathway
    PC1_1956
   00051 Fructose and mannose metabolism
    PC1_1956
   00052 Galactose metabolism
    PC1_1956
  Energy metabolism
   00680 Methane metabolism
    PC1_1956
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    PC1_1956
Enzymes [BR:pct01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PC1_1956
Protein phosphatases and associated proteins [BR:pct01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PC1_1956
Messenger RNA biogenesis [BR:pct03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     PC1_1956
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat DUF1357_C Glyco_tran_WecB
Motif
Other DBs
NCBI-ProteinID: ACT12997
JGI: PC1_1956
UniProt: C6DGU8
Position
complement(2246951..2247931)
Genome map
AA seq 326 aa AA seqDB search
MKIGLVISGGDVSGINNFIFQVNRMTDADIVIFDGGINGLIDNCCKAITRRDLVDYSISS
MPLMTSGRRAGKCRKADYEKIVKNIQKQKLDALIMAGGDGSFQFLKKLSHYGVHCYGVGM
TIDNDISGNSYTIGFSTACEQVMSEVEKLRNTGRGLQGRVFMIELLGGYCGELTLQAALK
SNADIALIPESPWDMDTLSQCIREKIAEQNSVIILCSEGYTQEYTPGFQGAIDTIIKKLE
HKIGIRIRKTILGYGLRNGAPTGEEIIQGTLLAEEVVRCINTGLTNKIIIINNNNKAIPI
DLEESECRLVDVESHFYKLAKAHHLI
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattggattagtcattagtggcggcgatgttagcggaataaataacttcatcttt
caggtgaacagaatgacagatgctgacatcgttatttttgatggtggaattaatggcctt
atcgacaattgctgcaaagcgattactcgccgcgatctggttgattattccatctcatca
atgccgttgatgacgtcagggagaagagcaggaaaatgcagaaaagctgattatgagaaa
atcgttaaaaatatacaaaaacaaaaactcgatgcgctcatcatggctgggggtgatgga
tcattccaatttctcaagaagctcagccactatggtgtccattgctacggcgtaggaatg
acgattgacaatgatatttcaggaaacagctacacgattggtttttctaccgcctgcgaa
caggtaatgagtgaggtagaaaagttacgcaatacgggccggggattacaaggccgagta
ttcatgattgaactgctgggcggttattgtggggaattaacattacaggccgcattaaaa
agcaatgctgatattgcgcttattccagagtcaccctgggacatggatacgttatcacaa
tgtattcgggaaaagattgcagaacagaatagcgtgattattttatgctctgaaggttat
acccaggaatatacacccggctttcagggcgcgatcgacaccattatcaagaagctagag
cacaaaattggaatccgtatccgaaagactattttgggatatggtttacgaaatggcgcg
cccaccggggaagaaattattcagggcacccttttagcagaggaagtcgttcggtgtatc
aacactgggctgacaaataaaatcattattattaataacaacaacaaagctattcccatc
gacctagaggagtccgaatgccgcttagtcgatgtagaaagtcatttttataagctcgcg
aaagctcatcatcttatatga

DBGET integrated database retrieval system