KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_1980Help
Entry
PC1_1980          CDS       T00934                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:pct00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PC1_1980
   00052 Galactose metabolism
    PC1_1980
   00500 Starch and sucrose metabolism
    PC1_1980
   00520 Amino sugar and nucleotide sugar metabolism
    PC1_1980
Enzymes [BR:pct01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PC1_1980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2273628..2274539
Genome map
AA seq 303 aa AA seqDB search
MSIVNKKVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGINEIILV
THSSKNSIENHFDTSFELEAILEKRVKRQLLEEVQSICPKHVTIMQVRQGLAKGLGHAVL
CAHPLVGDEPVAVILPDVIIDEYASDLKKDNLSEMLQRFSTTGHSQIMVEPVENVSSYGV
VDCKGVELKAGDSAPMVGVVEKPKASEAPSNLAVVGRYVLSADIWSLLEKTPPGAGNEIQ
LTDAIAMLMEKETVEAYHLKGVSHDCGNKLGYMQAFVEYGLRHDGLGQEFAQWLQETIEA
EEK
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgtctattgtgaataaaaaagtaaaaaaagcggtcataccggttgctggattagggacg
cgtatgctgcctgccaccaaagccattcctaaagaaatgttgccgttggtagataagccg
ctgatccaatatgttgttaatgagtgtatcgctgcagggattaatgaaattattctggtt
acacactcttctaagaattctatcgaaaaccatttcgataccagttttgagctggaagcc
atactagaaaaacgcgttaaacgtcagctgttggaagaagttcaatctatctgtcctaaa
cacgtcaccattatgcaagtgcgtcagggattagctaaagggctgggccatgccgtattg
tgcgcgcacccgttagtgggagatgaacccgtcgcagttattctgccggatgtgattatt
gatgagtatgcatccgatctgaagaaagataacctgagcgaaatgttgcaacgtttttct
actacaggccacagccagattatggttgagccggttgaaaatgtaagcagctatggcgtg
gttgattgcaaaggtgtggaattaaaagcaggggatagtgcacctatggtgggcgtggtt
gaaaaaccgaaagcttccgaggcaccgtctaatttagccgtcgttggccgttatgtactc
tctgcggatatttggtccctactggagaaaaccccgccgggtgctggcaatgaaattcag
ttaaccgatgccatcgcaatgttgatggaaaaagagacggtagaagcctatcacctgaaa
ggtgtgagccatgactgtggtaataaattaggctatatgcaggcattcgtggaatatggt
ttgcgccatgacggtttaggtcaggaatttgcgcaatggctgcaggaaacgattgaagca
gaagaaaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system