KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_1980Help
Entry
PC1_1980          CDS       T00934                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
pct00040  Pentose and glucuronate interconversions
pct00052  Galactose metabolism
pct00500  Starch and sucrose metabolism
pct00520  Amino sugar and nucleotide sugar metabolism
pct01100  Metabolic pathways
pct01130  Biosynthesis of antibiotics
Module
pct_M00362  Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:pct00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PC1_1980
   00052 Galactose metabolism
    PC1_1980
   00500 Starch and sucrose metabolism
    PC1_1980
   00520 Amino sugar and nucleotide sugar metabolism
    PC1_1980
Enzymes [BR:pct01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PC1_1980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ACT13021
JGI: PC1_1980
UniProt: C6DGX2
Position
2273628..2274539
Genome map
AA seq 303 aa AA seqDB search
MSIVNKKVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGINEIILV
THSSKNSIENHFDTSFELEAILEKRVKRQLLEEVQSICPKHVTIMQVRQGLAKGLGHAVL
CAHPLVGDEPVAVILPDVIIDEYASDLKKDNLSEMLQRFSTTGHSQIMVEPVENVSSYGV
VDCKGVELKAGDSAPMVGVVEKPKASEAPSNLAVVGRYVLSADIWSLLEKTPPGAGNEIQ
LTDAIAMLMEKETVEAYHLKGVSHDCGNKLGYMQAFVEYGLRHDGLGQEFAQWLQETIEA
EEK
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgtctattgtgaataaaaaagtaaaaaaagcggtcataccggttgctggattagggacg
cgtatgctgcctgccaccaaagccattcctaaagaaatgttgccgttggtagataagccg
ctgatccaatatgttgttaatgagtgtatcgctgcagggattaatgaaattattctggtt
acacactcttctaagaattctatcgaaaaccatttcgataccagttttgagctggaagcc
atactagaaaaacgcgttaaacgtcagctgttggaagaagttcaatctatctgtcctaaa
cacgtcaccattatgcaagtgcgtcagggattagctaaagggctgggccatgccgtattg
tgcgcgcacccgttagtgggagatgaacccgtcgcagttattctgccggatgtgattatt
gatgagtatgcatccgatctgaagaaagataacctgagcgaaatgttgcaacgtttttct
actacaggccacagccagattatggttgagccggttgaaaatgtaagcagctatggcgtg
gttgattgcaaaggtgtggaattaaaagcaggggatagtgcacctatggtgggcgtggtt
gaaaaaccgaaagcttccgaggcaccgtctaatttagccgtcgttggccgttatgtactc
tctgcggatatttggtccctactggagaaaaccccgccgggtgctggcaatgaaattcag
ttaaccgatgccatcgcaatgttgatggaaaaagagacggtagaagcctatcacctgaaa
ggtgtgagccatgactgtggtaataaattaggctatatgcaggcattcgtggaatatggt
ttgcgccatgacggtttaggtcaggaatttgcgcaatggctgcaggaaacgattgaagca
gaagaaaaataa

DBGET integrated database retrieval system