KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_1983Help
Entry
PC1_1983          CDS       T00934                                 

Definition
iron-containing alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pct00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    PC1_1983
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PC1_1983
   00620 Pyruvate metabolism
    PC1_1983
   00650 Butanoate metabolism
    PC1_1983
  Lipid metabolism
   00071 Fatty acid degradation
    PC1_1983
  Amino acid metabolism
   00350 Tyrosine metabolism
    PC1_1983
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PC1_1983
   00626 Naphthalene degradation
    PC1_1983
Enzymes [BR:pct01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PC1_1983
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     PC1_1983
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2276424..2279099)
Genome map
AA seq 891 aa AA seqDB search
MAVTNVAELNALVERVRKAQQEFATYTQEQVDKIFRAAALAASDARIPLAKMAVAESGMG
IVEDKVIKNHFASEYIYNAYQDEKTCGVLSTDDTFGTITIAEPIGLICGIVPTTNPTSTA
IFKALISLKTRNGIIFSPHPRAKNATNKAADIVLQAAIAAGAPKDIIGWIDQPSVELSNQ
LMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVVDETADIKRAVASILMSKTF
DNGVICASEQSVIVVDSVYDAVRERFATHGGYMLKGKELHAVQGILLKNGSLNADIVGQP
APKIAEMAGISVPANTKVLIGEVTAVDESEPFAHEKLSPTLAMYRAKDFNDAVIKAEKLV
AMGGIGHTSCLYTDQDNQPERVNHFGNMMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIALEEVASDGAK
RAFIVTDRFLFNNGYVDQVTSVLKQHGLETEVFFEVEADPTLSIVRKGAEQMHSFKPDVI
IALGGGSPMDAAKIMWVMYEHPTTHFEELALRFMDIRKRIYKFPKMGVKAKMVAITTTSG
TGSEVTPFAVVTDDATGQKYPLADYALTPDMAIVDANLVMNMPKSLCAFGGLDAVTHSLE
AYVSVLANEYSDGQALQALKLLKENLPDSYRDGAKNPVARERVHNAATIAGIAFANAFLG
VCHSMAHKLGSEFHIPHGLANALLISNVIRYNANDNPTKQTTFSQYDRPQARRRYAEIAD
HLRLTAPSDRTAQKIEKLLNWLEEMKTELGIPTSIREAGVQEADFLAKVDKLSEDAFDDQ
CTGANPRYPLISELKQILLDTYYGRKFSEEAKAEVVEPVAKAAKTGKKAAH
NT seq 2676 nt NT seq  +upstreamnt  +downstreamnt
atggccgtaaccaacgttgctgaacttaacgcactggtcgaaagagtgagaaaggcacag
caggaatttgccacttacactcaggaacaagtggacaagatcttccgcgctgctgcactc
gctgcatcggatgcgcgtattccgctggcaaaaatggcggttgccgaatccggtatgggg
atcgtggaagataaagtcatcaaaaaccacttcgcctctgaatacatttataacgcctat
caggatgaaaaaacctgcggcgtcctctcaactgatgacacttttggtacgattaccatt
gcagagcctattggcctgatttgcggtattgttcccaccaccaaccccacttctaccgcg
atttttaaagcgctgattagcctgaagacccgtaacgggattatcttctctccgcatccg
cgtgcaaaaaatgcgaccaataaagccgcagacattgttctgcaagcggcgattgcagca
ggtgcaccgaaagatatcatcggctggatcgatcagccttccgttgaattgtccaaccag
cttatgcaccatcccgatatcaacctgattctggctactggtggcccaggtatggtgaag
gccgcgtacagttccggtaaacccgcaatcggcgtaggtgcaggtaacacgccggttgtc
gttgacgaaaccgcagatatcaaacgtgccgttgcttctattctgatgtcgaaaactttc
gataacggcgtaatttgtgcgtcagagcaatcagtcatcgtcgtagacagcgtctatgac
gccgtgcgtgaacgttttgctacccacggcggctacatgctgaaaggcaaagaactgcat
gccgtacagggcattttgctgaagaacggttcactgaatgctgacatcgtgggtcaaccc
gcaccgaagattgcagaaatggcgggcatcagcgtccctgccaacaccaaagtgctgatc
ggtgaggtcaccgcggtcgatgagtccgaaccatttgctcatgaaaaactgtctccgacg
ctggcgatgtaccgtgcgaaagacttcaacgacgccgtgattaaagcggaaaaattggtc
gcaatgggtggtatcggtcacacatcctgcctgtataccgatcaggacaatcagcctgag
cgcgtgaatcatttcggcaatatgatgaaaaccgcgcgtatcctgattaacacacctgcg
tctcaggggggtatcggcgatctctacaacttcaaactcgctccgtctctgacgctgggc
tgtggctcctggggcggaaactccatctccgaaaacgtcggtccgaagcatttgatcaac
aagaaaacggtagccaagcgagcagagaatatgttgtggcataaacttcctaaatccatt
tatttccgtcgcggctcactgcccatcgcgcttgaagaagtggcctccgatggtgcaaaa
cgcgcctttatcgtaactgaccgcttcctgttcaataatggctatgtcgatcaagtgaca
tctgtattgaaacagcacgggctggaaaccgaagtgttctttgaagttgaagctgaccca
acgctgagcatcgtgcgtaaaggcgccgagcaaatgcactccttcaaaccggatgtgatc
attgcgctgggtggtggttcaccaatggatgcggcgaaaatcatgtgggtgatgtatgaa
caccctacgacacacttcgaagagctggcgctacgtttcatggatattcgtaaacgtatc
tacaagttcccgaaaatgggcgtcaaagccaaaatggtggccattaccaccacctccggt
acgggttccgaagtgacgccgtttgccgtggtgaccgacgatgcaaccgggcagaaatat
ccgttagcggactatgcgctgacgccagatatggcgattgttgatgccaatctggtgatg
aacatgccgaaatcactgtgtgcgtttggtggactcgatgcggtaacacactcactggaa
gcctatgtttccgtactggcaaacgaatattcagacggacaggcgttgcaagcgctgaag
ctgctgaaagagaacctgccagatagctaccgcgacggggcgaaaaacccggttgcccgt
gagcgcgtgcataacgctgcgacaattgctggtatcgcgtttgccaacgccttcctcggt
gtctgccactccatggcgcataagctgggctctgaattccatatcccgcacggcctggct
aacgccctgctgatctcaaacgtgattcgttataacgcgaacgataacccgaccaagcag
acgacgttcagccagtatgaccgtccgcaggctcgccgtcgctacgcggaaatagccgac
cacctgcgcttgaccgcaccaagcgatcgtaccgcgcagaaaatcgagaaattgctgaac
tggctggaagaaatgaagactgagctggggatccccacctcgattcgtgaagctggcgta
caggaagccgatttcctggctaaggtagataagctgtcagaagatgcattcgacgatcag
tgtaccggggctaacccacgttacccgctgatttccgaactgaaacagattctgctggat
acttactatggtcgtaagttctctgaagaggcgaaagcagaagtagttgagcctgtagca
aaagccgctaaaaccggtaagaaagctgcacattaa

DBGET integrated database retrieval system