KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_2002Help
Entry
PC1_2002          CDS       T00934                                 

Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pct00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PC1_2002
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PC1_2002
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PC1_2002
Enzymes [BR:pct01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PC1_2002
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2297816..2298622)
Genome map
AA seq 268 aa AA seqDB search
MERYQQLFNRLSEKKEGAFVPFVTLGDPSPEQSLKIIDTLIAAGADALELGVPFSDPLAD
GPTIQDANLRAFAAGVTPGQCFEMLATIRQKYPDIPIGLLMYANLVFSNGIDEFYQRCAQ
VGVDSVLVADVPVAESAPFRTAALRHGIAPIFICPPNADDELLREIASYGRGYTYLVSRA
GVTGAEKRAQLPLNHLVAKLNEYHAAPPLQGFGISDPTQVRETLASGAAGAISGSAIVRI
IEKNLNQPDVMLSELHTFVSEMKAATRS
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggagcgttatcaacagctgtttaatcgcctgtcagaaaaaaaggaaggcgcgttcgtt
ccctttgtcacactgggcgatccctccccagagcagtctctgaaaattatcgacacgctg
attgccgccggtgccgatgcgctggagttaggcgtgcccttctctgacccactggcagat
ggcccaaccattcaggatgccaacctgcgcgcctttgctgccggcgtcacccccggccag
tgcttcgaaatgctggcaaccattcgtcagaaatacccagacatcccgattggcctgctg
atgtatgccaatctggtcttcagcaacggcattgatgaattctatcagcgctgcgcgcag
gttggcgttgattcggtgttagtggcagatgttccggtggcggagtcagcgcctttccgt
acggctgcgctgcggcatggcattgctcctatttttatctgcccgcccaatgccgacgat
gaactgctgcgcgagatcgcttcctatggccgcggttatacctatttagtgtcgcgtgcg
ggcgtaaccggggcagaaaaacgcgcccaactgccgctgaatcatttggtagccaaactg
aacgagtaccatgctgcccctccgctgcaaggatttggtatttccgatcctactcaggtg
cgggaaacgttagcatcaggcgctgcgggtgccatttctggctcggcgatcgtgcggatt
atcgaaaagaatctgaaccagcctgacgttatgctgtcagagttacacacctttgtgagt
gaaatgaaagccgctacgcgctcataa

DBGET integrated database retrieval system