KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_2002Help
Entry
PC1_2002          CDS       T00934                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
pct00260  Glycine, serine and threonine metabolism
pct00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pct01100  Metabolic pathways
pct01110  Biosynthesis of secondary metabolites
pct01130  Biosynthesis of antibiotics
pct01230  Biosynthesis of amino acids
Module
pct_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pct00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PC1_2002
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PC1_2002
Enzymes [BR:pct01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PC1_2002
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth
Motif
Other DBs
NCBI-ProteinID: ACT13043
JGI: PC1_2002
UniProt: C6DGZ4
Position
complement(2297816..2298622)
Genome map
AA seq 268 aa AA seqDB search
MERYQQLFNRLSEKKEGAFVPFVTLGDPSPEQSLKIIDTLIAAGADALELGVPFSDPLAD
GPTIQDANLRAFAAGVTPGQCFEMLATIRQKYPDIPIGLLMYANLVFSNGIDEFYQRCAQ
VGVDSVLVADVPVAESAPFRTAALRHGIAPIFICPPNADDELLREIASYGRGYTYLVSRA
GVTGAEKRAQLPLNHLVAKLNEYHAAPPLQGFGISDPTQVRETLASGAAGAISGSAIVRI
IEKNLNQPDVMLSELHTFVSEMKAATRS
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggagcgttatcaacagctgtttaatcgcctgtcagaaaaaaaggaaggcgcgttcgtt
ccctttgtcacactgggcgatccctccccagagcagtctctgaaaattatcgacacgctg
attgccgccggtgccgatgcgctggagttaggcgtgcccttctctgacccactggcagat
ggcccaaccattcaggatgccaacctgcgcgcctttgctgccggcgtcacccccggccag
tgcttcgaaatgctggcaaccattcgtcagaaatacccagacatcccgattggcctgctg
atgtatgccaatctggtcttcagcaacggcattgatgaattctatcagcgctgcgcgcag
gttggcgttgattcggtgttagtggcagatgttccggtggcggagtcagcgcctttccgt
acggctgcgctgcggcatggcattgctcctatttttatctgcccgcccaatgccgacgat
gaactgctgcgcgagatcgcttcctatggccgcggttatacctatttagtgtcgcgtgcg
ggcgtaaccggggcagaaaaacgcgcccaactgccgctgaatcatttggtagccaaactg
aacgagtaccatgctgcccctccgctgcaaggatttggtatttccgatcctactcaggtg
cgggaaacgttagcatcaggcgctgcgggtgccatttctggctcggcgatcgtgcggatt
atcgaaaagaatctgaaccagcctgacgttatgctgtcagagttacacacctttgtgagt
gaaatgaaagccgctacgcgctcataa

DBGET integrated database retrieval system