KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_2004Help
Entry
PC1_2004          CDS       T00934                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase., Phosphoribosylanthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
pct00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pct01100  Metabolic pathways
pct01110  Biosynthesis of secondary metabolites
pct01130  Biosynthesis of antibiotics
pct01230  Biosynthesis of amino acids
Module
pct_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pct00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PC1_2004
Enzymes [BR:pct01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     PC1_2004
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     PC1_2004
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI
Motif
Other DBs
NCBI-ProteinID: ACT13045
JGI: PC1_2004
UniProt: C6DGZ6
Position
complement(2299829..2301196)
Genome map
AA seq 455 aa AA seqDB search
MQETVLHKIVRDKALWVAEREKAQPLASFQHEIVPSQRDFYQALKQDKPAFILECKKASP
SKGLIRDDFDPVAIAKVYKDYASAISVLTDEKYFQGDFAFLPQVSAAVHQPVLCKDFIIS
PYQIYLARYYQADAILLMLSVLDDEQYLQLADVAHSLKLGVLTEVSNEEELERAIQLEAR
VVGINNRDLRDLSIDLNRTRTLSSRLPAGVTVISESGINRHAQIRELSAFAQGFLIGSSL
MSEPDLNGAVRRVILGENKVCGLTRAEDAQAAYQAGALYGGLIFVASSPRYVDAKHAADV
MTGAPLRYVGVFRNAPVEHIVAITTQLGLAAVQLHGDEDQQTIDKLRQQLPATCLIWKAL
SIADTLPARNLTHVDRYVFDNGQGGSGKTFNWSLLANQSLDNVLLAGGLNSDNCALAAQQ
GCAGLDFNSGVESEPGKKDSHKIAAVFATLRQPQR
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaaaccgtattacataaaattgtgcgcgataaggcgctttgggttgcggagaga
gagaaagcacagccgctggcctcttttcagcatgaaattgttcccagccagcgcgacttt
tatcaggcactgaaacaggataagcccgcttttattctggaatgcaaaaaggcctcgccg
tcgaaaggattgattcgcgacgatttcgacccggtagcgattgccaaggtttataaagat
tacgcgtccgcgatttccgttttaaccgacgagaaatattttcagggtgactttgccttt
ctgccgcaggtgagtgcggctgtgcatcagccagtattgtgcaaagactttattatttcg
ccctaccagatctatctggctcgctactatcaggccgatgccattctgctgatgctatcc
gtgctggacgacgagcaatacctgcaactggccgacgtggcacacagtctgaagctaggt
gtcttgacggaagtcagtaatgaagaagagctagagcgggccattcagttggaagcgcgc
gttgtcggaatcaacaaccgcgatctgcgcgatctctccattgacctcaaccgcacccgg
acgctctcctcgcgtctgcccgctggcgtcaccgtgatcagcgagtccggcatcaaccga
catgcccagattcgtgaactcagcgcctttgcccaggggttcttgatcggcagttcactg
atgtcagaacccgatctgaacggcgcagtacgccgcgttattctgggagaaaacaaggtc
tgcggcctgacgcgtgccgaggatgctcaagcggcttatcaagccggtgcgctctacggc
ggattaatcttcgtcgccagttcaccacgctatgttgacgctaaacacgccgccgacgtc
atgacaggcgctccactgcgctatgtcggcgttttccgtaatgcgcctgtcgaacacatc
gttgctatcacgacgcagttggggctagcggccgttcagctacacggcgatgaagatcaa
cagacgatcgacaagctacgccagcaactccctgcgacttgcctgatttggaaagcgctg
agcatcgcggacaccctgccagcgcgtaatctcacccacgtcgatcgctacgtgtttgac
aacggtcagggcggcagcgggaaaaccttcaactggtcgctgttggcgaatcaatcattg
gataacgtgctgttagccggcggcctgaatagcgataactgcgcgctggcagcacagcaa
ggttgcgcaggactggatttcaattccggggtagaaagcgaaccgggaaaaaaagactca
cataaaattgctgcggtttttgcgacattacgtcagccacagcgctaa

DBGET integrated database retrieval system