KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_2337Help
Entry
PC1_2337          CDS       T00934                                 

Definition
glycoside hydrolase family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pct00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2686424..2687941)
Genome map
AA seq 505 aa AA seqDB search
MWMRRNQIVRKLTLGVVTTVLGMSLSFSALSATPVETHGQLSIENGRLVDEQGKRVQLRG
ISSHGLQWFGDYVNKDSMKWLRDDWGINVFRVAMYTAADGYISNPSLANKVKEAVAAAQS
LGVYIIIDWHILSDNDPNIYKAQAKTFFAEMAGLYGNSPNVIYEIANEPNGGVTWNGQIR
PYALEVTETIRSKDPDNLIIVGTGTWSQDIHDAADNQLPDPNTLYALHFYAGTHGQFLRD
RIDYAQSRGAAIFVSEWGTSDASGNGGPFLPESQTWIDFLNNRGVSWVNWSLNDKSEASA
ALAPGASKTGGWTEQNLSTSGKFVRAQIRAAANLSGGDTPTTPTEPTNPGSGTTGDVVLQ
YRNVDNNPSDDAIRMAVNIKNTGSTPIKLSDLQVRYYFHDDGKPGANLFVDWANVGPNNI
VTSTGTPAASTDKANRYVLVTFSSGAGSLQPGAETGEVQVRIHAGDWSNVNETNDYSYGA
NVTSYTNWDKITVHDKGKLIWGVEP
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgtggatgagaaggaatcaaatcgtcaggaaattgacgttaggggtggtaacaacggtg
ctggggatgtcgctcagtttttctgcattatccgccacaccggtggaaacgcatggtcaa
ctgtccattgaaaatgggcgactggtggacgaacaggggaaaagggtgcaactgagaggg
atcagttcgcacggtttgcagtggtttggtgactacgtcaacaaagattcgatgaaatgg
ctgcgtgatgactgggggattaacgtattccgtgttgccatgtacacggcagcggatggc
tatatttccaatccttctctcgcgaataaggtcaaagaagccgttgcggcggcacaaagc
ctcggcgtctacatcatcatcgactggcacattttgtcggataacgatcctaatatttat
aaagcacaggcaaaaaccttctttgccgaaatggcggggctgtacggtaattcgccgaac
gtgatttatgaaatcgccaatgaacctaacggcggcgtgacatggaacgggcaaattcgg
ccttatgcgctggaagtgactgaaactatccgtagtaaagatcctgataatctgattatc
gttggcacgggtacctggagtcaggatattcatgacgcggcggataatcaactgcccgac
ccgaatacgctgtacgcgctgcatttctatgccggtacgcacgggcagttcctgcgcgat
cgcattgattatgcacaaagccgcggtgctgcgatttttgtcagcgagtgggggacaagc
gatgcgtccggcaatggcggaccgttcctgcctgaatcgcagacctggatcgatttcctg
aataaccgtggtgtgagctgggttaactggtcgcttaacgataaatcagaagcgtctgcg
gcgctggctccgggagcgagcaaaacaggcggttggacggagcagaatctgtcgacgtca
ggcaaatttgtcagagcacagattcgcgcggctgcgaatctaagcggtggcgatacgcca
accacgccaacggaaccgaccaatccaggtagcggaaccacgggtgacgtcgtgctgcaa
tatcgtaatgtggataacaacccttccgatgatgcgattcgcatggccgtcaacatcaaa
aataccggaagtacgccgatcaaacttagcgatctgcaagtgcgctactacttccatgat
gatggcaaaccgggtgcgaacctctttgttgattgggcgaatgtcggccctaacaacatt
gtgaccagcacaggtacgccagccgccagtaccgataaagccaatcgctatgttcttgtg
accttcagcagcggagccggttctcttcagccgggtgcagaaaccggtgaagtgcaggtg
cgtatccacgccggagactggagcaacgtgaatgaaacgaatgactattcatacggtgct
aacgtcacgagctacaccaactgggataagatcaccgtacacgataaaggtaagctgata
tggggcgtggagccgtaa

DBGET integrated database retrieval system