KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_2468Help
Entry
PC1_2468          CDS       T00934                                 

Definition
Peroxiredoxin (EC:1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:pct00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    PC1_2468
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PC1_2468
Enzymes [BR:pct01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PC1_2468
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2833117..2833668)
Genome map
AA seq 183 aa AA seqDB search
MSTEIYAIPLTTIDGKATTFEAFKGQVALVVNVASQCGLTKQYDALEKLYETYRDKGLVV
LGFPSNEFAGQEPGSEAEIQAFCRGTFGVQFPMFSKIEVNGENRHPLYQLLIREQPEANG
TWKSDFFARLVNKGRKPKNPEDILWNFEKFLVDREGHVIDRFAPDMAPDHDTIVKAIDDA
LAK
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgagtactgaaatctacgctattccactgactactatcgacgggaaagcgacaacgttt
gaggcgtttaaagggcaggttgctttagtcgtcaacgtcgcctctcaatgcggcctgacg
aagcaatacgacgcgctggaaaaactctatgaaacctatcgtgacaaaggcttggtcgtg
ctgggattcccctccaatgaatttgctgggcaggaaccggggtcggaagcagagatccag
gcgttctgccgtgggacgtttggcgttcagttcccgatgttcagcaagattgaagtgaat
ggcgagaatcgtcatccgctgtaccagctgttaattcgtgaacagccagaagccaacgga
acctggaaaagtgacttttttgcgcgtttggtcaataagggacgtaagcctaagaacccg
gaagacattctgtggaatttcgaaaaatttctggtggatcgcgaagggcatgtgattgat
cgctttgcgccggatatggcacctgaccatgacactatcgtgaaagcgatcgacgatgcg
ctggcaaaataa

DBGET integrated database retrieval system