KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_2468Help
Entry
PC1_2468          CDS       T00934                                 

Definition
Peroxiredoxin (EC:1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:pct00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:pct00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2833117..2833668)
Genome map
AA seq 183 aa AA seqDB search
MSTEIYAIPLTTIDGKATTFEAFKGQVALVVNVASQCGLTKQYDALEKLYETYRDKGLVV
LGFPSNEFAGQEPGSEAEIQAFCRGTFGVQFPMFSKIEVNGENRHPLYQLLIREQPEANG
TWKSDFFARLVNKGRKPKNPEDILWNFEKFLVDREGHVIDRFAPDMAPDHDTIVKAIDDA
LAK
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgagtactgaaatctacgctattccactgactactatcgacgggaaagcgacaacgttt
gaggcgtttaaagggcaggttgctttagtcgtcaacgtcgcctctcaatgcggcctgacg
aagcaatacgacgcgctggaaaaactctatgaaacctatcgtgacaaaggcttggtcgtg
ctgggattcccctccaatgaatttgctgggcaggaaccggggtcggaagcagagatccag
gcgttctgccgtgggacgtttggcgttcagttcccgatgttcagcaagattgaagtgaat
ggcgagaatcgtcatccgctgtaccagctgttaattcgtgaacagccagaagccaacgga
acctggaaaagtgacttttttgcgcgtttggtcaataagggacgtaagcctaagaacccg
gaagacattctgtggaatttcgaaaaatttctggtggatcgcgaagggcatgtgattgat
cgctttgcgccggatatggcacctgaccatgacactatcgtgaaagcgatcgacgatgcg
ctggcaaaataa

DBGET integrated database retrieval system