KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_2725Help
Entry
PC1_2725          CDS       T00934                                 

Definition
(GenBank) Acireductone dioxygenase ARD
  KO
K08967  1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
pct00270  Cysteine and methionine metabolism
pct01100  Metabolic pathways
Module
pct_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:pct00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    PC1_2725
Enzymes [BR:pct01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     PC1_2725
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     PC1_2725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ARD Cupin_2 Cupin_1 AraC_binding Cupin_3
Motif
Other DBs
NCBI-ProteinID: ACT13755
JGI: PC1_2725
UniProt: C6D9Z9
Position
3087292..3087813
Genome map
AA seq 173 aa AA seqDB search
MTTLSIYHRPHITQPVQQLTAFTDIASLLASAGIQLEHWHTDAPPPDASNETILTQYHAD
IERLKQQEGYTSADVISLTPDHAERLALREKFLQEHTHSEDEVRFFVRGSGSFFVPIGEQ
VFQLTCEAGDLLRVPANTPHWFDCGEFPDFVAIRIFTNPEGWVGHFTGRETFH
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgctctcgatttatcaccgcccgcacatcacacagcccgtccagcagctcacc
gcgtttactgacatcgcttccctgctcgccagcgccgggatccagttggaacactggcac
actgacgcaccgccgcctgacgccagcaacgaaaccatcttgacgcagtatcatgccgat
attgagcgtctcaaacagcaagagggctacacctctgccgatgtgatcagcctgacgccg
gatcatgccgagagactggcgctgcgggaaaaatttcttcaggaacacacccatagtgaa
gatgaagtgcgcttcttcgttcgcggcagcggaagcttctttgtgccgattggcgagcag
gttttccagcttacctgcgaggccggcgatctcttacgcgttcccgccaacacgccgcac
tggtttgactgcggcgaatttcctgattttgtcgcgatccgcatttttactaatccagaa
ggctgggttgggcactttaccgggcgggagacgtttcactaa

DBGET integrated database retrieval system