KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_2774Help
Entry
PC1_2774          CDS       T00934                                 

Definition
class I and II aminotransferase
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pct00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    PC1_2774
   01230 Biosynthesis of amino acids
    PC1_2774
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PC1_2774
   00290 Valine, leucine and isoleucine biosynthesis
    PC1_2774
Enzymes [BR:pct01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     PC1_2774
    2.6.1.66  valine---pyruvate transaminase
     PC1_2774
Amino acid related enzymes [BR:pct01007]
 Aminotransferase (transaminase)
  Class I
   PC1_2774
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3147805..3149019
Genome map
AA seq 404 aa AA seqDB search
MSPIEKSKKLENVCYDIRGPVLKEAKRLEEEGNKVLKLNIGNPAPFGFEAPDEILVDVIR
NLPTAQGYCDSKGLYSARKAIVQHYQARDMRDITVEDVYIGNGVSELIVQSMQALLNPGD
EMLVPAPDYPLWTAAVSLSNGNAVHYLCDESSDWFPDLDDIRKKITSNTRGIVIINPNNP
TGAVYSKELLLDIVAIAREHNLIIFADEIYDKILYDDAQHHSIAALAPDLLTVTFNGLSK
TYRVAGFRQGWMVLNGPKKHAKGYIEGLEMLASMRLCANVPMQHAIQTALGGYQSISEFI
QPGGRLYEQRNRSWELINQIPGVSCVKPRGALYMFPRIDAKRFNIHDDQKLVLDLLLQEK
VLLVQGTAFNWPYPDHVRIVTLPRIDELDMAIHKLGRFLGHYHQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgtctccgattgaaaaatccaagaaactggagaacgtatgctatgacatccgtggccca
gtcttaaaggaagccaaacggcttgaagaagaaggtaataaagtccttaagctgaatatt
ggtaacccagctccttttggcttcgaggcaccggacgagattctggtcgatgtcatccgt
aacctgcccacggcacagggctactgtgattccaaaggcctctattccgcccgcaaagcc
atcgttcagcattatcaggcgcgggatatgcgcgatattacggttgaagatgtctacatt
ggtaacggtgtgtccgagctcatcgtgcaatccatgcaggcactgcttaacccaggcgat
gaaatgctggttcctgcgccggactacccactttggaccgcagccgtttctctgtctaac
ggcaacgccgttcactacctctgcgatgagtcctccgattggttccccgacctggatgat
atccgtaaaaagatcacgtccaatactcgcggtattgtcattatcaacccgaacaatcca
acgggcgcggtctacagtaaagagttgctgctggatatcgtggcgattgcacgcgaacat
aacctgatcatcttcgctgacgaaatttacgacaaaattctgtatgacgatgcacagcat
cactcgattgccgcactcgcgccggacctgctgacggtcacattcaacggcctgtccaaa
acgtaccgtgtagcaggtttccgtcaaggctggatggtactgaacggtccgaaaaaacac
gccaaaggctatattgaagggctggaaatgctggcttccatgcgtctgtgcgctaatgtg
ccaatgcagcatgcgattcagactgcgctgggcggctatcagagcatcagcgaatttatt
cagcccggcggacgcctgtacgagcagcgcaaccgttcctgggaactgatcaatcagatt
cccggcgtatcatgcgtaaaaccgcgcggcgcgctgtatatgttcccacgcattgatgcc
aaacgctttaatatccatgacgaccaaaaactggtgctggatctcctgttacaggaaaaa
gtgttgctggttcagggaaccgcatttaactggccttacccagaccatgttcgcatcgtc
acgctgccgcgtatcgatgagctggatatggcaatccacaaattagggcgtttcttgggg
cactatcaccagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system