KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_2797Help
Entry
PC1_2797          CDS       T00934                                 

Definition
FolC bifunctional protein
Orthology
K11754  
dihydrofolate synthase / folylpolyglutamate synthase [EC:6.3.2.12 6.3.2.17]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pct00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PC1_2797
Enzymes [BR:pct01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.12  dihydrofolate synthase
     PC1_2797
    6.3.2.17  tetrahydrofolate synthase
     PC1_2797
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3168630..3169898)
Genome map
AA seq 422 aa AA seqDB search
MDTLQTPQATSPLVTWLHYLEHLHAQAIDLGLERVKQVAEHLHLLQPAPTVFTVAGTNGK
GTTCCTLESILLAAGLRVGVYSSPHLVRYTERVRIQGKELPEAQHTQAFADIEAGRGAVS
LTYFEFGTLSALQLFKQANLDVVILEVGLGGRLDATNIVDADVSVVTSIAIDHTDWLGND
RESIGREKAGIFRQSRPAVVGEPDMPGTIADVAADKGALLRRRGRDWDYSVQRETWSWQD
KQRELSRLPLPNVPLANAATALAALHYSSLNVSEDAIRQGLQHATLPGRFQTVQESPRLI
LDVAHNPHAAAYLANRLAALPTSGKIRAVVGMLSDKDIAGTLAYLTPLVDEWYCAPLEGP
RGATAQQIAEHLTRSQSFPDVVAAWQQAMSEAAEQDIVIVCGSFHTVAHVMEALDEEKAN
GE
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggatacacttcaaacacctcaagccacgtcacctttggtcacgtggcttcattatctt
gagcacctgcacgctcaggccattgatttaggtctggagcgcgttaagcaggttgctgaa
catctccatttgctacagcctgccccaacggttttcaccgtcgcggggacgaacggcaag
ggaaccacctgctgtacgctggaatccattctgctggccgcagggctgcgggttggcgtt
tacagttctccccatcttgttcgctataccgagcgggtgcgtattcagggcaaagaattg
cctgaagcgcaacacactcaggcatttgcggatatcgaagcaggacgaggggcggtatcg
ctcacctattttgaattcggtacgctgtcggcgctgcaactctttaagcaggcgaacctg
gatgtcgtcatcctggaagtggggcttggtgggcgcctggacgccaccaatatcgtggat
gcggatgtctccgtcgttaccagcatagctatcgaccataccgactggttaggtaatgat
cgggaaagcatcggtcgtgagaaagccgggatattccgacagagtagacctgccgttgtc
ggcgagccggatatgccgggaacgattgccgatgttgccgctgataaaggggcactgctg
cgccgtcgtggtcgcgactgggactattccgttcagcgcgaaacgtggagctggcaggat
aagcagcgtgagttatcacggctgccattacctaatgtcccgttggcgaatgccgccacg
gcgctggctgcattgcactattcgtcacttaatgtgagcgaagacgcgattcggcaaggg
ttacagcacgcgacactaccggggcgttttcagacggtgcaagagtcaccgcgattgatt
cttgatgttgcgcacaatccccatgcggcggcgtatctggcaaatcggttggccgcgttg
ccgacctccggaaaaatacgggccgtcgtcggtatgctgtcggataaagatattgccggt
acgctggcctatttaacaccgttggtggatgagtggtattgcgcgccgctggaagggccg
cgtggtgccaccgcgcagcagattgccgagcacctgacgcgcagccaatcgttccctgat
gtcgtggcggcctggcagcaggcgatgtccgaggcggcggagcaggatatcgtcattgta
tgtggatcttttcatacggtagcgcatgtaatggaagcgctggatgaggagaaggcgaat
ggcgagtaa

DBGET integrated database retrieval system