KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_2821Help
Entry
PC1_2821          CDS       T00934                                 

Definition
(GenBank) fatty acid oxidation complex, alpha subunit FadJ
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
pct00071  Fatty acid degradation
pct00280  Valine, leucine and isoleucine degradation
pct00281  Geraniol degradation
pct00310  Lysine degradation
pct00362  Benzoate degradation
pct00380  Tryptophan metabolism
pct00410  beta-Alanine metabolism
pct00640  Propanoate metabolism
pct00650  Butanoate metabolism
pct00903  Limonene and pinene degradation
pct00930  Caprolactam degradation
pct01040  Biosynthesis of unsaturated fatty acids
pct01100  Metabolic pathways
pct01110  Biosynthesis of secondary metabolites
pct01120  Microbial metabolism in diverse environments
pct01130  Biosynthesis of antibiotics
pct01200  Carbon metabolism
pct01212  Fatty acid metabolism
Module
pct_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pct00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PC1_2821
   00650 Butanoate metabolism
    PC1_2821
  Lipid metabolism
   00071 Fatty acid degradation
    PC1_2821
   01040 Biosynthesis of unsaturated fatty acids
    PC1_2821
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PC1_2821
   00310 Lysine degradation
    PC1_2821
   00380 Tryptophan metabolism
    PC1_2821
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PC1_2821
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PC1_2821
   00281 Geraniol degradation
    PC1_2821
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PC1_2821
   00930 Caprolactam degradation
    PC1_2821
Enzymes [BR:pct01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     PC1_2821
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PC1_2821
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     PC1_2821
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: ACT13851
JGI: PC1_2821
UniProt: C6DAL7
Position
complement(3193804..3195987)
Genome map
AA seq 727 aa AA seqDB search
MNDQQPFSAITESPSAFSLTIRPDNIGVIGIDVPGEKVNTLKSEFAQQILSVFEQARQHA
TLRGLILISSKPDSFIAGADITMLNQCRSAEQAENLAKQGQETFEQIAALPFPVVAAIHG
ACLGGGLELALACDYRVCSLDEKTVLGLPEVQLGLLPGSGGTQRLPRLIGLDSALDLILT
GRHLRANQALRQGLVDEAVPHDILLDTAVEMLKKGKRKAEPLGWRSRLLSSPGIRHVLFK
MVKRKTRAKTHGNYPATEKIIQVVRRGVEKGREEGYRQEARAFGKLVMTPESAALRHLFF
ASNALKKTSGAASDAKPIHYVGILGGGLMGGGIASVTATRGQLPVRIKDINEQGINHALK
YNWQLLTQRVQRKRMKPTERQRLMTLISGSTDYRGFEHADIVIEAVFEDLALKRQMVAEI
EDHAAPHTIFASNTSSLPIHQIAEGARRPQQVIGLHYFSPVDKMPLVEVIPHAHTSAETV
ATTVALARKQGKTAIVVGDSAGFYVNRILAPYINEAAYCLLEGEPIESIDYALVRFGFPV
GPFALLDEVGIDVATKIVPVLSEELGTRFTSPPAFDAILKDGRKGRKNGKGFYRYNKTRR
FWQTGREVDSSIYPLLDVTAKAHIDPALISQRGVMMMLNEAARCLDEGVIQCARDGDIGA
VFGIGFPPFLGGPFHYMDRLGMETVVKTLLVLQQQYGDRFAPCERLLAMREGQRTFYPPT
DEDDSAS
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatcaacagcctttctctgccataacggaaagcccctctgccttttccctcacg
attcggccggataatatcggcgtgatcggcattgacgttcccggcgagaaggtaaacacg
ctaaaaagcgaatttgcacagcagattctttcggtcttcgagcaagcgcgacaacatgcg
acgctcagggggctgatcctgatttcctccaaacctgattcgtttatcgcgggtgcggac
atcaccatgttgaaccagtgtcgcagtgctgaacaggctgaaaatctggcaaagcagggg
caggaaacctttgagcagattgctgcattaccgttccccgtggtggccgcgattcacggc
gcttgtctgggcggcgggctggaactggcattagcctgcgattatcgcgtttgttcgctg
gatgaaaaaacggtgctggggttaccggaagtgcagcttggactccttcccggatcaggc
ggaacgcagcgtttgccgcggttgattggtctggatagcgcgctcgatctcattctgacc
ggtcgccatctccgcgcgaatcaggcgttacggcagggactggtcgatgaggccgttccg
cacgatattctgctggataccgcagtcgagatgctcaaaaaaggaaaacgtaaagcggag
ccgctaggctggcggtcgcgcctgctgagcagtccgggcattcgccatgtacttttcaag
atggtgaagcgtaaaacccgtgcgaaaacacacggcaactatccggccactgaaaagatt
attcaggtcgtgcgccggggagtggaaaagggtcgtgaagaaggataccgacaggaggcg
cgggcgttcggtaagctggtgatgacgccggaatctgccgcgctacgccatttgttcttt
gcttccaacgcattaaagaaaacctctggtgcagcctctgacgcgaaaccgatccactac
gtcggcattcttggcggcgggttgatgggaggagggatcgccagcgtgacggcgacgcgc
gggcagttgccggtgcggattaaagatatcaatgagcagggtatcaaccatgcgttgaag
tacaactggcaactgttgacccagcgcgttcagcgtaaacggatgaagccgacggagcgt
cagcggttgatgacgttgatttccggcagtacggattatcgcgggtttgaacatgcggat
attgtcattgaggccgtgttcgaagatctggcgctgaagcggcaaatggtggcggagatt
gaagatcatgccgcaccgcatacgattttcgcatccaacacctcatcgctgccaatccat
cagattgcggaaggcgcgcgccgtccacagcaggttattgggctgcactattttagtccg
gtagacaaaatgccgctggttgaagtgattccccatgctcataccagtgccgaaacggtg
gcgacgacggttgctctagccagaaagcagggaaaaaccgcgatcgtcgtgggtgacagc
gccggtttttatgtgaaccgcatattggcaccttatatcaatgaagcggcttactgcctg
ctggaaggcgagccaattgaatcgatcgactatgcgctggtgcgctttggtttccccgtt
ggtccgtttgcgctgcttgatgaagtgggcatcgatgtcgcgaccaaaattgtgccagtg
ctaagtgaagaactgggcacacgtttcacctctccgcctgcgtttgatgcgatcctgaaa
gatgggcgcaaagggcgtaagaatgggaaagggttctatcgatacaataaaacgcgccgt
ttctggcagacggggagggaggttgatagctcaatttacccgctgctggatgtgacggca
aaggctcacatcgaccctgcgctaattagccaacgtggcgtaatgatgatgctgaatgag
gcggcgcgttgcctggatgaaggtgtgattcaatgtgcgcgcgatggtgatatcggggcg
gtctttggtattggtttcccaccgtttcttggcggaccgttccactacatggatcgtctg
gggatggaaaccgtcgtgaaaacactactggtgctgcaacaacagtatggcgatcggttc
gcgccctgtgagcgtttgcttgcgatgcgggaaggtcagcggacgttttatccgccaacc
gatgaggacgatagcgctagttaa

DBGET integrated database retrieval system