KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_2962Help
Entry
PC1_2962          CDS       T00934                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:pct00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    PC1_2962
Enzymes [BR:pct01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     PC1_2962
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3342229..3344286
Genome map
AA seq 685 aa AA seqDB search
MFKFPPLSSKVPVLLHGADYNPDQWLDNPEVLEKDIEMMKQTQCNVMSVGIFSWSGLEPE
EGRYEFGWLDSLLDTLYANGIFVFLATPSGARPAWLSQKYPDVLRVGSNRVRALHGGRHN
HCLSSPNYREKVKQMNTQLAKRYSHHPAVIGWHISNEYSGECHCDTCRSTFQSWLKARYG
TIDALNKAWWSTFWSHTYTDWSQLEPPSPVGEVSIHGLNLDWKRFNTSQVSDFCAAEIAP
LKAENPSLPTTTNFMEYFYDYDYWQLAKVIDFISWDSYPLWHNAEDDCALGAYTAMYHDL
MRTLKGGKPFYLMESTPSLTNWQPISKLKKPGMHILSSLQAVAHGSDSVQYFQWRKSRGS
VEKFHGAVVDHVGHIDTRVGREVQELGDILNKLAPVAGSRVDAKVAIIFDWESRWAMDNA
QGPRNAGLFYEKTVTEHYRTFWEQGVAVDIINADVDLSGYQLVIAPMLYMVRDGFAERVD
AFVKQGGRFVTTYWSGVVNETDLCHLNGFPGPLRPIMGVWAEEIDGLYDHESNSISGLSG
NEQGLVGPYQVTHLCELIHLEGARALATYDGDFYAGRPAVTVNDYGKGQAYYIASRNDLA
FQRDFFTTLIQTLALPRALPTDLPYGIVAHRRDDGENEFIFVQNYTATPQHITLPAAYEE
MTTGSTLSGSITLSGYGCRILRRTL
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaattccccccgctaagcagcaaagtccctgttctgctacacggtgctgactat
aatcctgaccaatggctggacaacccagaggttctggaaaaagacattgaaatgatgaag
cagacccagtgcaacgtcatgtccgtgggtattttcagttggtctgggcttgagccggaa
gaaggccgctacgaatttggctggctggacagcctcctcgacacgctgtatgccaacggc
atcttcgtttttctggcaacgcccagcggtgcgcgcccggcctggctgtcgcagaaatac
cctgacgtgctgcgagtgggtagcaaccgcgtacgggcgctgcacggcggtcgccacaat
cactgcctgagctcgccgaattatcgcgaaaaagtaaaacagatgaacacccagttggca
aaacgctactcgcaccatcctgcggtgatcggctggcatatttccaacgaatacagtggc
gagtgccactgcgatacctgccgcagcaccttccaaagctggctgaaagcccgctacggt
acgattgacgcactgaataaagcatggtggagcaccttctggagccacacctataccgac
tggtcacagctagaaccaccgtcgcctgtcggtgaggtgtcgattcacggcctgaatctg
gactggaaacgctttaacacctcacaggtcagtgatttctgtgccgcagaaatcgcaccg
ctcaaagccgaaaatccgtctctgccaaccacgacgaacttcatggaatacttctatgat
tacgactactggcagttggcaaaggtgatcgacttcatctcctgggacagctatccgctg
tggcataacgcggaagacgactgcgcgctgggtgcttataccgcgatgtatcacgacctg
atgcgtacgctgaaaggcggaaagcccttctatctgatggagtcaacgccgagcctgacc
aactggcagccgatcagcaagttgaaaaagccgggtatgcacatcctgtcttcgcttcag
gccgtcgcgcacggttccgactccgtgcaatatttccagtggcgtaagagccgcggttcc
gtcgagaaattccacggcgctgtcgtcgatcatgtcgggcatattgatacccgcgtcggg
cgtgaagtgcaggaactgggtgatatcctcaacaaactcgctccagtggcaggcagccgg
gttgacgccaaagtcgccatcattttcgactgggaaagccgctgggcgatggataacgct
caagggccgcgcaacgccgggctgttctacgaaaaaaccgttaccgaacattatcgtacg
ttctgggaacagggcgtggcggtggacatcatcaacgccgatgtcgatctcagcggctat
cagctcgtgattgcgccaatgctttacatggtacgcgatggctttgccgaacgcgtcgat
gccttcgtcaaacagggcggccgcttcgtcaccacctactggtctggcgtcgtcaacgaa
accgatctgtgccatctgaacggtttccctggcccacttcgtcctatcatgggagtttgg
gcggaagaaatcgacgggctgtacgatcatgaaagcaatagcatcagcggcctgagcggt
aacgagcaaggtctggtcggcccgtatcaggtcacgcacctgtgcgagctgattcacctt
gagggcgcgcgagcgctggcgacctatgacggcgatttctacgccggacgtccggccgtt
acggtcaatgattacggcaaaggtcaggcctattacatcgcctcacgcaacgacctcgcc
ttccagcgtgatttcttcaccacgctgatacagacgctggctctaccgcgcgcgctaccg
actgacctgccttacgggattgtcgctcatcgtcgcgatgacggggaaaacgagtttatc
ttcgtacagaactacacggcgacgccgcagcacattacgctgcctgccgcctacgaagaa
atgaccaccggcagcacgctgtcaggatccatcacgctgtcaggctacggctgccggatc
ttgcgccgcacgctgtag

DBGET integrated database retrieval system