KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_2984Help
Entry
PC1_2984          CDS       T00934                                 

Definition
(GenBank) Alcohol dehydrogenase zinc-binding domain protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
pct00010  Glycolysis / Gluconeogenesis
pct00071  Fatty acid degradation
pct00350  Tyrosine metabolism
pct00625  Chloroalkane and chloroalkene degradation
pct00626  Naphthalene degradation
pct01100  Metabolic pathways
pct01110  Biosynthesis of secondary metabolites
pct01120  Microbial metabolism in diverse environments
pct01130  Biosynthesis of antibiotics
pct01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pct00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PC1_2984
  Lipid metabolism
   00071 Fatty acid degradation
    PC1_2984
  Amino acid metabolism
   00350 Tyrosine metabolism
    PC1_2984
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PC1_2984
   00626 Naphthalene degradation
    PC1_2984
Enzymes [BR:pct01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PC1_2984
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 CoA_binding Methyltransf_25 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ACT14007
JGI: PC1_2984
UniProt: C6DBE4
Position
3371377..3372387
Genome map
AA seq 336 aa AA seqDB search
MKAAIVTKDHSVEIQDKTLRPLQHGEALLKMECCGVCHTDLHVKDGDFGDVTGITLGHEG
IGIVKEVGPGVTSLKPGDRASVAWFYQGCGHCEYCNSGNETLCRSVKNAGYSVDGGMAEE
CIVVADYAVKVPDGLDSAAASSITCAGVTTYKAVKVSQIKPGQWIAIYGLGGLGNLALQY
AKNVFNAKVIAIDVNDAQLAFAKEMGADLVINPAKDDAAKIIQENVGGAHAAVVTAVARA
AFNSAVDAVRAGGRIVAVGLPPESMDLNIPRLVLDGIQVLGSLVGTREDLKEAFQFAAEG
KVKPKVTLRPLKDINAIFAEMKGGKITGRMVIDLSI
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagccattgtaacgaaggatcattccgttgagattcaggacaaaacactgcgc
cctctccaacacggggaagccctgctaaaaatggaatgctgtggcgtatgccacaccgac
ctgcacgtcaaagacggggattttggtgatgttaccggcatcacactcggccatgagggc
atcggtatcgtcaaagaggtgggtccgggtgtgacatcactgaaacccggcgatcgtgcc
agcgtagcctggttctatcagggctgtggtcactgtgaatattgtaatagcggtaacgaa
accctgtgccgctcggtgaaaaacgcgggctactccgtcgatggtggaatggcggaagag
tgcattgtcgttgccgattacgcggtaaaagtgccggatggtctggattctgccgcggcc
agcagcattacctgcgcgggcgtgaccacctataaagcggtgaaagtctcacaaatcaag
ccaggacagtggatcgccatctatggtctgggcggactgggcaatctggcgctccaatac
gccaagaacgtctttaatgcgaaggtcatcgcaattgatgtcaacgatgcacagctggcc
tttgctaaagagatgggcgcggatctggtcatcaacccagccaaagacgatgccgccaag
atcattcaggaaaacgtgggcggcgcgcacgctgctgtggtcactgccgttgcgcgtgcg
gcatttaactccgcagtcgatgccgttcgcgcaggcgggcgtattgtcgccgtcggcctg
ccaccggaatcaatggatctgaatattccacgcctggtgctggatggcattcaggtattg
ggatcgctggtcggcacgcgtgaagatctgaaagaagccttccagtttgctgccgaaggg
aaagtgaaaccaaaagtgacgcttcgcccgctgaaagacatcaacgccattttcgctgaa
atgaaaggcgggaaaattaccggccgtatggtaatcgacctgtcaatctaa

DBGET integrated database retrieval system