KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_3047Help
Entry
PC1_3047          CDS       T00934                                 

Definition
pectinesterase (EC:3.1.1.11)
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pct00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PC1_3047
   00500 Starch and sucrose metabolism
    PC1_3047
Enzymes [BR:pct01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     PC1_3047
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3434458..3435564
Genome map
AA seq 368 aa AA seqDB search
MIKASNLCKTLTLAMLISSPWSLAQAADYNALVSTNAGDANAYKTITEAIASAPADSSPF
VIYVKNGVYHERLTITRPNIHLQGESRDGTVITATTAAGTLKPDGSKWGTYGSNTVKVDA
PDFSARSLTISNDFDYPANQAKANDDPTKLKDSQAVALLVDDKGDRVWFHDVSLTGYQDT
LYVKGGRSFFSKCRISGTVDFIFGNGTALFDNCDIVARNRTDVKNQPIGYLTAPSTNIKQ
KYGLVIINSRVIKEKGVPAKSYGLGRPWHPTTTFDDGRYADPNAIGQTVFLNTSMDDHIY
GWDKMSGKDKQGNTIWFHPQDSRFFEYKSSGKGAEKNDQRRQLSDAEAAEYTPAKVLAGW
VPTAPKGK
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgataaaagcctcaaacctctgcaaaacgctgaccttagctatgctaatttcctcaccg
tggtcgttagcgcaggcagccgactacaatgctctcgtttccaccaatgcaggggacgcc
aacgcctacaaaaccattacagaagccatcgccagcgcaccggcagacagctcaccgttt
gttatctatgtgaaaaatggtgtctaccacgagcgcctgaccattacgcgccctaacatt
catctacagggcgaaagccgtgacggcaccgtgatcaccgcgacaaccgcagccggcacg
ctcaaacccgatggcagtaaatggggaacctatggcagcaacacggtgaaggtcgatgct
cccgatttcagcgcccgttctctgaccatcagcaatgatttcgattacccggccaatcag
gccaaagccaatgacgaccccaccaagctaaaagactcgcaggccgttgcgctactggtt
gatgacaaaggcgatcgtgtctggttccacgatgttagcctgacgggctatcaggacacg
ctctatgtgaaagggggacgcagtttcttctccaaatgccgaatcagcggcaccgttgat
ttcatctttggtaatggtaccgcgctgtttgacaattgcgacattgtcgcgcgtaaccgt
accgacgtgaaaaatcagccgattggctacctcaccgcccccagcaccaatattaaacaa
aaatatggtttggtcattattaatagccgtgtgattaaagagaaaggcgttcccgcgaaa
agctatggtctgggccgcccctggcatccaacgaccacttttgacgatggtcgctatgcc
gatcctaacgccatcggtcagaccgtcttcctgaacaccagtatggacgaccacatctat
ggctgggacaaaatgtccggtaaagataaacaaggtaatacaatctggttccatccgcag
gactcacgctttttcgagtataaatccagcggtaaaggcgcagagaaaaacgatcaacgc
cgtcagttaagcgacgcggaagcggcagaatacaccccagccaaagtgctggcaggctgg
gtgcctaccgcgcctaaagggaagtag

DBGET integrated database retrieval system