KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_3178Help
Entry
PC1_3178          CDS       T00934                                 

Definition
glycoside hydrolase family protein
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Brite
Enzymes [BR:pct01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     PC1_3178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3592228..3592737
Genome map
AA seq 169 aa AA seqDB search
MKSLVKRCVIATVLALAALVPDFSLLKTSQEGLALIADLEGCRLSPYQCSANLWTNGIGH
TAGVVPGKTITEREAAVNLVADVLRVEKALARCMAVNMPQAVYDAIVSFAFNVGVGAACR
STLAFFINKGQWRNACDQLLRWVYVNGEVSRGIETRRQRERAVCLKGAA
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcactcgttaaacgctgcgttatcgcaacggtgttagcgctggccgcgttagtg
ccagatttttccttgctgaaaacgtcacaggaggggctggcgctgattgctgaccttgag
gggtgccgcttaagtccctatcagtgcagcgcgaacttgtggacaaacgggatcggacac
accgcaggcgtggtgccggggaaaaccatcaccgagcgtgaggcagcggtcaatcttgtg
gccgatgtgttacgggtagaaaaggcactggcgcgttgtatggccgtgaacatgccgcag
gccgtctatgatgccattgtgagctttgcgtttaatgtcggtgtcggtgcggcgtgtcgc
tctacgctggcgtttttcatcaacaaaggccagtggcgcaacgcctgtgaccagttgctg
cgctgggtgtatgtcaacggcgaggtatcacgcggtattgaaacccgtcgccagcgtgag
cgcgccgtctgtcttaagggggcagcatga

DBGET integrated database retrieval system