KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_3284Help
Entry
PC1_3284          CDS       T00934                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:pct00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PC1_3284
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PC1_3284
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    PC1_3284
Enzymes [BR:pct01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     PC1_3284
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3699091..3700194)
Genome map
AA seq 367 aa AA seqDB search
MSGSQTLVVKLGTSVLTGGSRRLNRAHIVELVRQCAQQHAAGHRIVIVTSGAIAAGREHL
GYPELPATIATKQLLAAVGQSRLIQLWEQLFSIYGIHVGQMLLTRADMEDRERFLNARDT
MRALLDNNIVPVINENDAVATAEIKVGDNDNLSALAAILADADKLLLLTDQAGLFTADPR
NNPDAELIREVNGINDALRSIAGDSVSGLGTGGMSTKLQAADVACRAGIDVVIAAGSKPG
VIGDVIADISVGTRFHAVDAPLESRKHWIFGAPPAGEITVDDGALSAILERGSSLLPKGI
RRVEGNFSRGEVIRVRSLAGRDVAHAVTRYNSDALRMIAGHHSQQIAEILGYEYGPVAIH
RDDMIIN
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcagccagactttggttgtgaaactgggcaccagcgtgctaaccggcggttcg
cgccgtcttaaccgcgcccacattgttgaactggtgcgccagtgcgcgcagcaacatgcg
gcagggcatcggattgttattgtcacctcaggagcgattgctgccgggcgtgaacatttg
ggttaccccgaactccccgccacgattgcgaccaaacaactactggccgccgtgggtcaa
agccgcctgattcagctgtgggaacagctgttttccatctacggtatccacgttgggcaa
atgctgctgacgcgtgcggatatggaagatcgtgagcgtttcctcaacgcgcgcgacacc
atgcgggcgctgctggataacaatattgttccggtcattaatgaaaacgacgccgttgcg
accgccgagatcaaggtgggtgacaacgacaacctgtctgcgctggcggcgattctggcc
gatgcggataagctgctgctgctgaccgatcaggccgggttgtttaccgccgatccgcgc
aataatcctgatgcggagctgattcgtgaagtgaacggcatcaatgatgcgctacgcagc
attgcgggtgacagcgtgtcaggcctcggaacgggcggtatgtcgactaaattgcaggct
gccgatgtggcctgtcgtgctggtatcgacgtggtgatcgccgcaggcagcaaaccaggt
gtgattggcgatgtcattgcagatatctccgttggaacgcgttttcatgccgtggatgcg
ccgctggaaagccgtaaacactggatttttggtgcgccacctgcaggggaaatcaccgtc
gacgacggcgcgctttcggcgatccttgaacgcggcagctcgctgctgccgaagggcatt
cgccgtgtggaagggaatttctctcgcggtgaagtgatccgcgtgcgcagcttggcgggc
cgcgatgtggcgcacgccgtgacgcgttataacagcgatgcgctgcgtatgattgccgga
caccactctcaacagattgccgagattcttggctacgaatatggtccggtggctatccat
cgcgacgatatgattatcaattaa

DBGET integrated database retrieval system