KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_3666Help
Entry
PC1_3666          CDS       T00934                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
pct00260  Glycine, serine and threonine metabolism
pct00750  Vitamin B6 metabolism
pct01100  Metabolic pathways
pct01110  Biosynthesis of secondary metabolites
pct01120  Microbial metabolism in diverse environments
pct01230  Biosynthesis of amino acids
Module
pct_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pct00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PC1_3666
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PC1_3666
Enzymes [BR:pct01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PC1_3666
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: ACT14681
JGI: PC1_3666
UniProt: C6DF17
Position
complement(4137503..4138792)
Genome map
AA seq 429 aa AA seqDB search
MKLYNLKDHNEQVSFAQAIKQGLGSQQGLFFPLDLPEFERTEIDALLDLDFVTRSSRILS
AYIGDEIAAETVFERVKAAFAFPAPVAPVAEDIAALELFHGPTLAFKDFGGRFMAQMLTE
VSGDEKITILTATSGDTGAAVAHAFYGLENVRVVILYPQGKISPLQEKLFCTLGGNIHTI
AVDSDFDACQALVKKAFDDEELKKAIGLNSANSINISRLLAQICYYFEAVAQLPQEARNQ
LVVSVPSGNFGDLTAGLLAKSLGLPIKRFIAATNANDTVPRFLSSGNWEPNKTVATLSNA
MDVSQPNNWPRVEELFRRKNWQLKTLGFGAVSDETTKETMHELDALGYVSEPHAAIAYRL
LRDQLQAGEFGLFLGTAHPAKFKESVEAILGKKLDLPEALAERADLDLLSHHFPDDFAKL
REFLMSLPK
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtacaaccttaaagatcataacgagcaggtcagctttgctcaggctatcaag
caagggctgggtagccagcaagggctgttcttcccgctggatctgccggaatttgagcgc
accgaaatcgacgcgctgctggatctggatttcgttacccgcagcagccgtattctgtct
gcgtatatcggcgatgaaattgcggctgaaaccgtgttcgagcgcgtaaaagcagcattt
gcgttccctgcgccggttgcaccggtagcggaagatatcgcggcactggaactgttccac
ggtccgacgctggcctttaaagatttcggcggccgctttatggcgcaaatgctgacggaa
gtgtctggcgacgagaaaattaccattctgacggcgacctctggcgacaccggtgcggcc
gtggcgcatgccttctacggtctggaaaatgtccgcgttgtgattttgtatccgcagggc
aagatcagtccattgcaggaaaaactgttctgtacgctgggtggcaacattcacaccatc
gctgtcgacagcgattttgatgcctgccaggcattggtgaaaaaggcatttgatgatgaa
gaactgaaaaaggcgattggcctgaactcggcaaactccatcaatatcagccgtctgctg
gcgcaaatttgctactactttgaagccgttgcacaactgccgcaagaagcgcgtaatcaa
ctggtggtttctgtgccgagcggtaacttcggcgatctgaccgctggtctgctggcaaaa
tcgctggggctgccgattaagcgcttcatcgctgcgaccaacgccaatgacaccgtgcca
cgtttcctgagcagtggaaattgggagccgaataaaacggtggcaaccttatccaacgcg
atggacgtgagccagccgaacaactggccgcgtgtggaagagttgttccgtcgtaaaaac
tggcagctgaaaacgctgggctttggcgcggtgagcgatgagaccacgaaagaaaccatg
catgagctggatgcgttaggctatgtttctgagccgcacgcggcgattgcttatcgtttg
ctgcgcgatcaactgcaagctggcgagttcggcctgttcctggggacggcgcacccggct
aaattcaaggaaagcgtagaagccattctgggcaaaaaactggacctgccggaagcgctg
gctgagcgtgccgatctggatctgctgtcgcaccacttcccggatgatttcgcgaagctg
cgtgaattcctgatgtcgctgccgaagtaa

DBGET integrated database retrieval system