KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_3666Help
Entry
PC1_3666          CDS       T00934                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pct00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PC1_3666
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PC1_3666
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PC1_3666
Enzymes [BR:pct01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PC1_3666
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4137503..4138792)
Genome map
AA seq 429 aa AA seqDB search
MKLYNLKDHNEQVSFAQAIKQGLGSQQGLFFPLDLPEFERTEIDALLDLDFVTRSSRILS
AYIGDEIAAETVFERVKAAFAFPAPVAPVAEDIAALELFHGPTLAFKDFGGRFMAQMLTE
VSGDEKITILTATSGDTGAAVAHAFYGLENVRVVILYPQGKISPLQEKLFCTLGGNIHTI
AVDSDFDACQALVKKAFDDEELKKAIGLNSANSINISRLLAQICYYFEAVAQLPQEARNQ
LVVSVPSGNFGDLTAGLLAKSLGLPIKRFIAATNANDTVPRFLSSGNWEPNKTVATLSNA
MDVSQPNNWPRVEELFRRKNWQLKTLGFGAVSDETTKETMHELDALGYVSEPHAAIAYRL
LRDQLQAGEFGLFLGTAHPAKFKESVEAILGKKLDLPEALAERADLDLLSHHFPDDFAKL
REFLMSLPK
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtacaaccttaaagatcataacgagcaggtcagctttgctcaggctatcaag
caagggctgggtagccagcaagggctgttcttcccgctggatctgccggaatttgagcgc
accgaaatcgacgcgctgctggatctggatttcgttacccgcagcagccgtattctgtct
gcgtatatcggcgatgaaattgcggctgaaaccgtgttcgagcgcgtaaaagcagcattt
gcgttccctgcgccggttgcaccggtagcggaagatatcgcggcactggaactgttccac
ggtccgacgctggcctttaaagatttcggcggccgctttatggcgcaaatgctgacggaa
gtgtctggcgacgagaaaattaccattctgacggcgacctctggcgacaccggtgcggcc
gtggcgcatgccttctacggtctggaaaatgtccgcgttgtgattttgtatccgcagggc
aagatcagtccattgcaggaaaaactgttctgtacgctgggtggcaacattcacaccatc
gctgtcgacagcgattttgatgcctgccaggcattggtgaaaaaggcatttgatgatgaa
gaactgaaaaaggcgattggcctgaactcggcaaactccatcaatatcagccgtctgctg
gcgcaaatttgctactactttgaagccgttgcacaactgccgcaagaagcgcgtaatcaa
ctggtggtttctgtgccgagcggtaacttcggcgatctgaccgctggtctgctggcaaaa
tcgctggggctgccgattaagcgcttcatcgctgcgaccaacgccaatgacaccgtgcca
cgtttcctgagcagtggaaattgggagccgaataaaacggtggcaaccttatccaacgcg
atggacgtgagccagccgaacaactggccgcgtgtggaagagttgttccgtcgtaaaaac
tggcagctgaaaacgctgggctttggcgcggtgagcgatgagaccacgaaagaaaccatg
catgagctggatgcgttaggctatgtttctgagccgcacgcggcgattgcttatcgtttg
ctgcgcgatcaactgcaagctggcgagttcggcctgttcctggggacggcgcacccggct
aaattcaaggaaagcgtagaagccattctgggcaaaaaactggacctgccggaagcgctg
gctgagcgtgccgatctggatctgctgtcgcaccacttcccggatgatttcgcgaagctg
cgtgaattcctgatgtcgctgccgaagtaa

DBGET integrated database retrieval system