KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_3778Help
Entry
PC1_3778          CDS       T00934                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
pct00630  Glyoxylate and dicarboxylate metabolism
pct01100  Metabolic pathways
pct01110  Biosynthesis of secondary metabolites
pct01120  Microbial metabolism in diverse environments
pct01200  Carbon metabolism
Module
pct_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:pct00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PC1_3778
Enzymes [BR:pct01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     PC1_3778
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase ETC_C1_NDUFA4
Motif
Other DBs
NCBI-ProteinID: ACT14793
JGI: PC1_3778
UniProt: C6DFQ4
Position
complement(4274251..4275558)
Genome map
AA seq 435 aa AA seqDB search
MTTSRTQQVQHIEKEWKTARWEGITRPYSAEDVINLRGSVNPECTLAQLGAAKLWNLLHG
DARKGYVNCLGALTGGQALQQAKAGIEAIYLSGWQVAADANLASSMYPDQSLYPANSVPA
VIERINNTFRRADQIQWANHIEPGDKRHTDYFLPIVADAEAGFGGVLNAFELMKSMIEAG
AAAVHFEDQLASAKKCGHMGGKVLVPTQEAIQKLVAARLAADVLGVPTLLVARTDADAAD
LLTSDCDEYDRDFITGERTVEGFYRTRAGIEQAISRGLAYAPYADLVWCETSTPDLSLAR
RFAEAIHAKFPGKLLAYNCSPSFNWKKNLDDSTIARFQDELSAMGYKYQFITLAGIHSMW
FNMFDLAHAYAQGEGMRHYVEKVQQPEFEAIKDGYTFSSHQQEVGTGYFDKVTNIIQGGE
SSVTALTGSTEEQQF
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgacgacctctcgtacccaacaagtccagcatattgaaaaagagtggaaaaccgcgcgc
tgggaaggtattacgcgcccctacagcgcagaagatgtgattaatctacggggttcggtg
aacccggaatgtacgctcgcgcagctcggtgctgcgaagctgtggaacctgctacatggt
gatgcgcgcaaaggctatgtgaattgcctgggcgcgctgaccggcggacaggctttacag
caggcgaaagcgggcattgaggcgatttacctttccggctggcaggtggcggcggatgcc
aatctggcgtccagcatgtatcccgatcagtcgctctacccggcgaactctgtgcccgca
gtgattgaacgcatcaataatacgtttcggcgtgccgatcagattcagtgggcgaaccac
attgagccgggcgacaagcgtcataccgactacttcctgccgattgtggcggatgcggag
gcgggatttggcggcgtgttgaatgcgtttgagctgatgaaatcgatgattgaagcgggt
gctgcggcggttcatttcgaggatcaactggcatcagcgaagaaatgcgggcacatgggg
ggcaaagtgctggtgccgacgcaggaagccattcagaaactggttgcggcgcgtctggcg
gcggatgtcttgggtgtgccgaccttactggttgcgcgaaccgatgcggatgcagcggat
ttgctgacttccgattgtgatgagtatgaccgtgatttcatcaccggagaacgtacggtg
gaaggcttctatcgcacgcgtgctggaattgagcaggcaatcagccgcggtttggcctac
gcaccgtatgccgatctggtgtggtgcgaaacctcaacgccggatttatcgctggcgcgt
cgttttgccgaagcaatccatgcgaagttccccggtaagctgttggcgtacaactgttca
ccttcctttaactggaagaaaaatctggatgacagcacgattgcgcgttttcaggatgag
ctgtcggcgatgggctataagtaccaattcattacgctggctggcattcatagcatgtgg
ttcaacatgtttgatctggcgcatgcctatgcgcagggtgaagggatgcggcactacgta
gaaaaagtgcagcagcctgaatttgaggcaattaaagacggctataccttctcatcacat
cagcaggaggtcggtaccggctacttcgataaggtgacgaacatcattcagggaggcgag
tcttcagtgacggcgctgacgggatcgacggaagaacaacagttctga

DBGET integrated database retrieval system