KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_3779Help
Entry
PC1_3779          CDS       T00934                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
pct00620  Pyruvate metabolism
pct00630  Glyoxylate and dicarboxylate metabolism
pct01100  Metabolic pathways
pct01110  Biosynthesis of secondary metabolites
pct01120  Microbial metabolism in diverse environments
pct01200  Carbon metabolism
Module
pct_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:pct00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PC1_3779
   00630 Glyoxylate and dicarboxylate metabolism
    PC1_3779
Enzymes [BR:pct01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     PC1_3779
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ACT14794
JGI: PC1_3779
UniProt: C6DFQ5
Position
complement(4275590..4277188)
Genome map
AA seq 532 aa AA seqDB search
MMQQTINRELAFSQRFGEGEKQILTEEAIDFLTELVAHFTPARNQLLAERQIQQRNIDQG
KLPDFISETASIRDGAWTIRGIPDDLQDRRVEITGPVERKMVINALNANVKVFMADFEDS
LSPGWEKVIDGQINLRDAVRGTISYINEAGKIYQLKPNPAVLICRVRGLHLPEKHVSWQG
EAIPGSLFDFALYFFHNYQELLKKGSGPYFYLPKTQSWQEAAWWNDVFCYTEDRFDLQRG
TIKATVLIETLPAVFQMDEILYHLRDHIVGLNCGRWDYIFSYIKTLKNHGDRVLPDRQSV
TMEKPFLSAYSRLLIKTCHRRGAFAMGGMAAFIPSKDAERNNWVLDKVRKDKELEAHNGH
DGTWVAHPGLADAVMEVFDRALGERKNQLNIGREQDAPIRAEELLEPCPGERTEVGMRAN
IRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIRHGKTLSDGRVITKALFRQ
MLAEEMFVIQEELGDARFSGGRFDDAARLMEQITTQDELIDFLTLPGYALLD
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgatgcagcagacgataaacagagaattggcgtttagtcagcgctttggcgaaggtgag
aagcaaattcttacggaggaagcgattgatttcttaacggagctggtcgcgcatttcacg
ccggcacgtaatcagttgctcgccgaacggcagatccagcagcgtaatatcgatcagggt
aagctgcctgattttatttcagaaacggcttccattcgtgatggagcatggacaatacgc
ggtattcccgatgaccttcaggatcgtcgcgttgagattaccggcccggttgaacgcaag
atggtaatcaatgcgttgaatgccaatgtgaaagttttcatggcggactttgaagattcg
ctgtcgccgggatgggaaaaggtcatcgacgggcaaatcaacttgcgggatgccgtacgc
ggtacgatttcctatatcaatgaagcaggaaaaatttaccagttgaagcccaatcctgct
gtattgatttgccgcgtgcgtgggttgcatttgcctgaaaaacacgtgtcctggcagggg
gaggccattcctggcagcctgtttgatttcgcactgtattttttccacaactatcaggag
ttgctgaagaaaggtagcggcccttacttctatctgcccaagacgcagtcatggcaggaa
gcggcctggtggaatgatgtcttctgttatacggaagatcgttttgacctgcagcgtggg
acgatcaaagcgacggtgttgattgaaacgctgcctgccgttttccagatggacgaaatc
ctctatcacttgcgcgatcatatcgttgggctgaactgcgggcgctgggattacatcttc
agctatatcaaaacattaaagaaccacggcgatcgcgtgctgcctgaccgccagtcggta
acgatggaaaaacccttccttagcgcttactcacggctgttgatcaagacctgtcatcgc
cgtggcgcgttcgccatgggtgggatggcagcgttcattccgagcaaggatgcggaacgc
aataactgggtattggataaggtacgtaaagacaaagagttggaagctcacaatgggcat
gatggcacctgggtggcccatccggggctggctgatgccgtgatggaggtgttcgatcga
gcgttaggtgagcgtaaaaatcagctcaatatcggccgtgagcaggatgcccccattcgt
gccgaggaattgcttgagccttgtccgggagagcgcacggaagtggggatgcgtgcgaat
attcgcgttgcggtgcagtacatcgaggcatggatatctggtaatggctgcgtcccgatt
tatgggctgatggaggatgcggcgacggcagaaatctcccgcacctcaatctggcagtgg
attcgccacggcaaaacattgagcgatggtcgagtgatcaccaaggcgctgttccgacag
atgttggccgaagagatgtttgtgattcaggaggagctcggcgatgcccgtttcagcgga
gggcgctttgatgacgccgcccggctgatggagcaaatcaccacgcaagatgagctgatc
gacttcctgacgttacccggctacgcattgcttgattaa

DBGET integrated database retrieval system