KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_3920Help
Entry
PC1_3920          CDS       T00934                                 

Definition
Alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pct00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:pct00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:pct02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4414097..4415842)
Genome map
AA seq 581 aa AA seqDB search
MKARWLLPLLISAALPGMVQAQAIYPIDRATMLAGGKFDFKVEFDEVLKPEDIRILINGK
DYQQVLGKTASFVEREDGGNASTIWLRDVNLPEAGKYVVEAEAKGKKTQVSWDVYSASGT
RKAKNVILFIGDGLSVAHRTGARILSKGVTEGKADGRLAIDDLQYMAFGGTSSTDSIAAD
SANTMSAYMTGHKSGVNALGVYVSRSKNSLDHPKQETLGELLTRSTKMSVGVVSDAELQD
ATPAAVVSHTRRRADKAEIVEMFYNVQPTVMLGGGSAYFLPKSTPGSKRKDETNYVEKFQ
QAGYSLVTDADSLKKNASQATKLLGLFHTGNMDGVMDRRFLKNDVAKKFPNQPDLTEMTQ
AALDVLSKNKDGFFLMVESALIDKASHPLDWERAFTNTIMLDQSVAIAKKFVEKNPDTMI
IVTGDHTHGLSIIGTVDDSKPGTEMREKVGVYEDAGYPNYKDANKDGYPDDLNVSKRLAV
FFNNYPDYYETFRPKLDGQFVPAIKNEKDEYVANKAYEKVPGAVFREGILPRSSDTGVHA
VDDMVIQASGPGAERIRGYMENTDLFRVIVDALAVKPQDKK
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctcgctggttactgcctttactgatttctgctgcgctgccaggaatggtgcag
gctcaggccatttatcccattgaccgcgccaccatgttggcgggcgggaaattcgatttt
aaagtcgagtttgatgaagtactcaagccggaagatatccgcattctgatcaacggcaaa
gattaccagcaggtgctgggcaaaaccgcctcgtttgttgagcgtgaagacggcggcaac
gcctccacgatctggctgcgagacgtaaacctgccagaagcaggcaaatatgtcgtcgaa
gcagaagctaaaggcaaaaaaacacaggtgagctgggacgtttattccgcgtccggtacg
cgtaaagccaagaacgtgattctgttcatcggcgatggcctgtccgttgcgcaccgcact
ggcgcgcgtatcctgtccaaaggggtgacggaagggaaagcggatggtcgtctggcgatt
gatgatctgcaatatatggcatttggcggtacttccagtaccgactccatcgcggccgat
agcgccaacaccatgagtgcttacatgaccggtcataaatccggtgtgaatgcgctgggt
gtgtacgtcagccgtagcaaaaattcactggatcacccgaagcaagaaacgctgggtgag
ctgctgacccgttctaccaaaatgtctgttggcgtcgtcagcgatgctgaacttcaggat
gctacgccagctgcggtcgtctcgcacactcgccgccgtgcggataaagctgaaatcgtt
gaaatgttctacaacgtgcagcctacggtcatgctgggtggcggttctgcctacttcctg
ccgaaaagcacgccgggttcaaagcgtaaagacgaaaccaactacgttgagaaattccag
caggcgggttattcactggttaccgatgcggattctctgaagaaaaacgcgtcacaggcc
accaaactgctgggactgttccacaccggcaatatggacggtgtgatggatcgtcgtttc
ctgaaaaatgacgttgccaagaaattccctaatcagcctgacctgactgaaatgacgcag
gcggcgctggatgtgctgtccaaaaacaaagacggtttcttcctgatggtagaatccgcg
ctgatcgacaaagcctctcacccactggattgggagcgtgcgtttactaacaccatcatg
ctggatcagtctgtcgcgatcgctaagaagttcgtggagaaaaacccagatacgatgatt
atcgtaacgggcgaccatacacatggcctgtctatcattggtacggtagatgacagcaag
ccgggtaccgagatgcgtgagaaagtcggtgtgtatgaagatgcaggctatccgaactat
aaagacgccaacaaagacggctacccggatgacctgaacgtttccaaacgtctggctgtg
ttcttcaacaactacccagactattacgaaacgttccgtccgaagctggatggccagttc
gttcctgctatcaagaacgaaaaagatgaatacgtagccaacaaagcctacgagaaagtg
ccgggtgcggtattccgtgaagggatcctgccacgctcttccgataccggcgttcatgct
gttgacgatatggtgattcaggctagcggcccaggtgcagaacgtatccgtggttacatg
gaaaacaccgacctgttccgggtcattgtggacgcgcttgcggtgaaaccgcaggacaaa
aagtaa

DBGET integrated database retrieval system