KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_3927Help
Entry
PC1_3927          CDS       T00934                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pct00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PC1_3927
Enzymes [BR:pct01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     PC1_3927
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4423566..4425650)
Genome map
AA seq 694 aa AA seqDB search
MFKVDKLASQQTGIAESYTDAYGKEHIVAAAIRNQIQAMMDVSDSGNAPLPPVRVFLQGR
DAVIELAGHGEFLWTLMYENGGQIQGQITGGSTLALPGVLPLGYHYLTLTQADQRWSCRI
IVAPHRCYEPEALQQGKRWWGVTVQLYTLRSQNNWGVGDFGDLRHLVEQIARRGGAFVGL
NPLHSLYPALPEAASPYSPSSRHWLNIIYIDVNRIDDFQQSEEAQAWWLREDTQSAVTAL
RAGRWVDYEPVTALKLTALRLAFRYFTTRSTLDPRISAFRQFVVSGGQSLQLQATFDALQ
AYLKKQGENYADWHQWPARYHDVHSETVKSFRREHSDEITFYSWLQWVAHEQLAECYAHS
KQLGLPLGLYRDLAVGVAQGGAETWDERQLYCLDASIGAPPDPLGPQGQDWQLAPMNPTM
MQLRGYQPFIDVLRSNMAHCGALRIDHVMALLRLWWIPKAETAGNGAYVHYPVDDLLAVL
ALESQRHRCLIIGEDLGTVPPEIVSKLHDYGIYSYKVLFFEKDEENHFRAPEDYPRQAMT
TITTHDLPTLRGYWQTVDLSLGRELGLYPTETLLQEQMQQREKAKQGLLNALHEFGLLPQ
RVGRNSALTTMGAPLSRGVHRYVADSASALVGFQLEDWLDMATPVNVPGTNREYPNWRRK
LTRPLESIFADRCLERLVRDMDLRRGAPMKTQKA
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
gtgttcaaggtggataaactggcaagccagcagacaggcatcgcggaaagctataccgat
gcctatggcaaagagcacattgttgcggccgcaatcagaaaccagattcaggcaatgatg
gacgtttctgacagcggcaatgcgcccttgccgcctgttcgtgtctttttgcagggccgg
gacgcggtcattgagcttgctggtcacggtgaattcctttggacgctaatgtatgaaaat
ggcggtcaaattcaggggcagatcacgggcggctctacgttggctctgccgggcgtgctg
ccgctgggttaccactacctgacgttgacgcaggccgaccagcgctggagttgccggatt
attgttgcgccgcaccgctgctacgaacccgaagccttacagcagggaaaacgctggtgg
ggtgttaccgtccagctttacaccttgcgttcgcagaacaactggggcgtcggggatttt
ggcgacctgcgccatctggtggaacagattgcccggcgcggcggtgcctttgtggggcta
aacccgctgcattcgctgtatcccgcgctgccagaggccgcaagcccttacagtccttcc
tcccgacactggctgaacattatttatattgatgtgaatcgcatcgatgattttcagcag
agcgaggaggcgcaggcatggtggctccgtgaggatacccaaagtgcggtgacggcgtta
cgggcagggcgctgggtcgattatgaaccggtaacggcgcttaagctgactgccttacgg
ttggctttccgctactttacgacacgcagcacgctggacccgcgtatcagtgcctttcgc
cagtttgtcgtcagcggcgggcagagcctgcaacttcaggcgacgtttgatgcgttgcag
gcctacctgaaaaagcagggtgagaactacgcggactggcaccaatggccagcccgttac
catgacgtgcacagtgaaaccgtgaagtcattccgccgtgaacacagcgatgagattacg
ttttacagttggctgcaatgggtggcgcatgagcaacttgcagagtgttacgcgcacagt
aaacagcttggcctgccgctcggtctgtatcgcgatttagccgttggggtcgcacagggc
ggcgcggaaacctgggatgaacggcagctctattgccttgatgcctctatcggtgcaccg
ccggatccgcttggaccacagggacaagactggcagctcgcgccgatgaaccccaccatg
atgcagctgcgcggctatcagccgtttatcgacgtactgcgcagtaacatggcgcactgt
ggtgcgctgcgtatcgatcacgtgatggcgctcttgcgcctgtggtggatccccaaggcg
gagacagcaggcaacggggcttacgtacattatccggttgacgatctgctggcggtgctg
gcgctggaaagtcaacgtcatcgctgcctgattatcggcgaggatttaggcacggttccg
ccggaaattgtcagcaaactgcatgattacggtatctattcttacaaggtgctgttcttt
gaaaaagatgaggagaaccatttccgcgcaccggaagattacccgcgtcaggcgatgaca
acgatcaccacgcacgatctcccgacgctgcgcggctactggcaaaccgtggatttatcg
ctgggacgggaattggggctgtacccgacggaaacgctattgcaagagcagatgcagcag
cgtgagaaagcgaaacaggggctgctcaacgcgttgcatgaattcgggctattgccgcag
cgggttggccgcaactcggcgctgacgacgatgggcgcgccgctgagtcgtggcgttcac
cgctatgtcgctgatagcgccagcgcgctggtggggttccaactggaagactggctggat
atggcgacaccggtcaatgtgccgggtaccaatcgtgaataccccaactggcggcgcaaa
cttacgcgcccgctggagtcgatctttgctgaccgctgccttgaacggctggttcgggat
atggatttgcgccgtggcgcaccaatgaaaacgcagaaagcctaa

DBGET integrated database retrieval system