KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_3961Help
Entry
PC1_3961          CDS       T00934                                 

Definition
Lysophospholipase (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:pct00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    PC1_3961
Enzymes [BR:pct01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     PC1_3961
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4470766..4471803)
Genome map
AA seq 345 aa AA seqDB search
MVQRHNTLFTSERLTPEGLTSNLLTREAQFAAFATGELLDFWRQREEGEFSGVDDVPIRF
VRFTAPQHDKIVVVFSGRIESYVKYSEVAYDLFHSGYDVLIMDHRGQGRSGRVLQDGHRG
HVVRFSDYVDDAETLCQQHIGPKHYIRRFALAHSMGGAILAQLLIRQPETFDAVALCAPM
FGIRLPLPHCVAGWIVDWAERRPAIRDYYAIGTGQWRPLPYRMNVLTHSRERYQRSIRFY
ADSPDLRVGGPTYHWVREAIQAGKQLQAQASAVTTPLLLLQAGEERVVDNRSQNAFCQAL
AQSGNANANGVLQVIPGARHEILFETDNLRAQAFALILAHFARYH
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggttcaacgccacaatacgttgtttacgtcggaacggttaacgcctgaggggttaacc
tcgaacctgctaacgcgagaagcgcagtttgccgcttttgctaccggagaattactggat
ttttggcgtcagcgtgaagagggcgaattctctggcgttgatgacgtccctatccggttt
gttcgttttaccgcgccacagcacgacaagattgtcgttgtcttttcaggccgcatcgaa
agctatgtcaaatatagcgaagtggcgtatgacctttttcatagcggctatgatgtactc
atcatggatcaccgtgggcaagggcgatcgggtcgcgtgttgcaagacggccaccgtgga
cacgttgtgcgtttcagtgattatgtcgatgacgccgaaacgctgtgtcagcagcacata
gggcctaagcactatatccgccggtttgcgttagcgcattcaatgggaggtgcgattctg
gcacaactgctgattcgccaacctgagacgtttgatgccgttgcgctgtgcgcgccgatg
tttggcattcgtttgccgcttcctcattgtgttgccggatggattgtcgattgggcagag
cgtcgtccggcgatacgtgattattacgctatcggcaccggacagtggcgtccgttgcct
tatcggatgaatgtgctgacgcacagccgtgaacgctaccagcgcagcattcgattttat
gcggactcgccggatttgcgcgtaggcggccccacttatcattgggtgcgtgaagcgata
caggcagggaaacagctacaggcacaggccagcgccgtcactacgccgctgctgctgttg
caggcgggggaggaacgcgtggtggataaccgcagccagaatgcgttttgtcaggcattg
gcgcagagcggtaacgccaatgcgaacggcgttctacaggttatccccggtgcgcggcat
gaaattctatttgaaacggataacctccgcgctcaggcatttgcgctgattttggcgcac
tttgcgcgttatcattaa

DBGET integrated database retrieval system