KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_3961Help
Entry
PC1_3961          CDS       T00934                                 

Definition
Lysophospholipase (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:pct00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4470766..4471803)
Genome map
AA seq 345 aa AA seqDB search
MVQRHNTLFTSERLTPEGLTSNLLTREAQFAAFATGELLDFWRQREEGEFSGVDDVPIRF
VRFTAPQHDKIVVVFSGRIESYVKYSEVAYDLFHSGYDVLIMDHRGQGRSGRVLQDGHRG
HVVRFSDYVDDAETLCQQHIGPKHYIRRFALAHSMGGAILAQLLIRQPETFDAVALCAPM
FGIRLPLPHCVAGWIVDWAERRPAIRDYYAIGTGQWRPLPYRMNVLTHSRERYQRSIRFY
ADSPDLRVGGPTYHWVREAIQAGKQLQAQASAVTTPLLLLQAGEERVVDNRSQNAFCQAL
AQSGNANANGVLQVIPGARHEILFETDNLRAQAFALILAHFARYH
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggttcaacgccacaatacgttgtttacgtcggaacggttaacgcctgaggggttaacc
tcgaacctgctaacgcgagaagcgcagtttgccgcttttgctaccggagaattactggat
ttttggcgtcagcgtgaagagggcgaattctctggcgttgatgacgtccctatccggttt
gttcgttttaccgcgccacagcacgacaagattgtcgttgtcttttcaggccgcatcgaa
agctatgtcaaatatagcgaagtggcgtatgacctttttcatagcggctatgatgtactc
atcatggatcaccgtgggcaagggcgatcgggtcgcgtgttgcaagacggccaccgtgga
cacgttgtgcgtttcagtgattatgtcgatgacgccgaaacgctgtgtcagcagcacata
gggcctaagcactatatccgccggtttgcgttagcgcattcaatgggaggtgcgattctg
gcacaactgctgattcgccaacctgagacgtttgatgccgttgcgctgtgcgcgccgatg
tttggcattcgtttgccgcttcctcattgtgttgccggatggattgtcgattgggcagag
cgtcgtccggcgatacgtgattattacgctatcggcaccggacagtggcgtccgttgcct
tatcggatgaatgtgctgacgcacagccgtgaacgctaccagcgcagcattcgattttat
gcggactcgccggatttgcgcgtaggcggccccacttatcattgggtgcgtgaagcgata
caggcagggaaacagctacaggcacaggccagcgccgtcactacgccgctgctgctgttg
caggcgggggaggaacgcgtggtggataaccgcagccagaatgcgttttgtcaggcattg
gcgcagagcggtaacgccaatgcgaacggcgttctacaggttatccccggtgcgcggcat
gaaattctatttgaaacggataacctccgcgctcaggcatttgcgctgattttggcgcac
tttgcgcgttatcattaa

DBGET integrated database retrieval system