KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_3965Help
Entry
PC1_3965          CDS       T00934                                 

Definition
(GenBank) Phospholipase A(2)
  KO
K01058  phospholipase A1/A2 [EC:3.1.1.32 3.1.1.4]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
pct00564  Glycerophospholipid metabolism
pct00565  Ether lipid metabolism
pct00590  Arachidonic acid metabolism
pct00591  Linoleic acid metabolism
pct00592  alpha-Linolenic acid metabolism
pct01100  Metabolic pathways
pct01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pct00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    PC1_3965
   00565 Ether lipid metabolism
    PC1_3965
   00590 Arachidonic acid metabolism
    PC1_3965
   00591 Linoleic acid metabolism
    PC1_3965
   00592 alpha-Linolenic acid metabolism
    PC1_3965
Enzymes [BR:pct01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     PC1_3965
    3.1.1.32  phospholipase A1
     PC1_3965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PLA1
Motif
Other DBs
NCBI-ProteinID: ACT14980
JGI: PC1_3965
UniProt: C6DHA7
Position
complement(4475270..4476142)
Genome map
AA seq 290 aa AA seqDB search
MHKIVLVLAALLMAQAHAETTTNVNAPAPNQPVVRGSIIASLLQEHDTPFVLYPYESNYL
LYTYTSNINKTAIQSYNWGDEARKDEVHYQLSLGFPIWRGILGDNSLLGASYTQRSWWQL
SNKSESSPFRETDYEPQVFLGWATNATLAGWTLRDVEVGFNHQSNGRSEPTSRSWNRAYA
RLMAQNGNWQVDVKPWIRFSDSQDDNPDITKYMGHYRLRVGYVWGDSVFSAEGRYNWNSG
YGGGELGWSYPLTRHVRFYTKVFSGYGESLIDYNHRQTRFGVGVTLNDMF
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgcataaaatagtactcgtactggcagcattactgatggcacaggctcatgctgaaaca
acaacaaacgtaaacgcgcctgcgccaaatcaaccggtggtacgtggcagcattattgcc
agtctgttacaagagcacgataccccgtttgtcctctatccttatgaaagtaactacttg
ctgtacacctataccagcaacatcaataaaacggcgatccagagctataactggggcgat
gaagcacgtaaagatgaagtgcattaccagttgagcctgggattcccgatctggcgtggc
attctgggtgataactcgctgctgggggcttcctatacgcagcgctcatggtggcaactg
tcgaataagagcgagtcttctccattccgtgaaacggattatgaacctcaggtctttttg
ggctgggcaacgaacgccaccctcgcgggctggacgctgcgggatgtggaagtgggcttt
aatcaccaatctaacggccgttccgaacccacttcacgcagttggaaccgcgcctatgcc
cgtctgatggcacaaaacggtaattggcaggttgatgtgaaaccgtggattcgtttctct
gatagccaggacgataacccggacatcaccaaatacatggggcattaccgcttacgcgtt
ggctatgtgtggggcgacagcgtgtttagcgcggaagggcgttataactggaacagcggc
tacggcggtggtgaactgggctggagctatccgctgacgcgtcatgttcgcttttatacc
aaggtctttagcggttacggtgaatcactgattgattacaaccaccgtcagactcgcttc
ggcgttggggtgacgctgaacgacatgttctaa

DBGET integrated database retrieval system