KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_3981Help
Entry
PC1_3981          CDS       T00934                                 

Definition
(GenBank) Uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
pct00860  Porphyrin and chlorophyll metabolism
pct01100  Metabolic pathways
pct01110  Biosynthesis of secondary metabolites
pct01120  Microbial metabolism in diverse environments
Module
pct_M00121  Heme biosynthesis, glutamate => heme
pct_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:pct00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PC1_3981
Enzymes [BR:pct01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     PC1_3981
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: ACT14996
JGI: PC1_3981
UniProt: C6DHC3
Position
4492025..4492765
Genome map
AA seq 246 aa AA seqDB search
MTILVTRPSPTGEQLVTRLRKLGYNAWHSPLIEFSPGRELASLPALLQTLRADDLVFALS
QHAIHYADPMLARAGIGWPAHLAYYAIGRTTALALHKTSAHPVIYPPERETSETLLQLPE
LQNISGKRALLLRGNGGRELLGETLTERGVQVTYCECYQRRDVHYDGPEQSRHWQQIGID
KLVITSGEMLQRIYTLVPDYYRASWLLGCRLIVVSERLAEQARQLGWRDIRVADNADNDA
LVRALQ
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgacaattctggttacccgtccgtcaccaactggcgaacaactggtgacccgtttaaga
aagcttggctataacgcctggcacagcccgctgatcgagttttcacccggacgagaactt
gccagcttgccagcactattacagacgctgcgcgccgacgatctggtgtttgcgctctca
caacatgcgattcattacgccgatccaatgctggcgcgtgcgggcatcggttggcctgcc
catctcgcttattatgcgattggtcgcaccacggcactggcgctgcataaaaccagcgcc
catccggtcatctaccctcccgaacgcgaaaccagcgaaacgctcctgcaactacctgaa
ctgcaaaatatttccggcaagcgcgcactattactgcgcggcaacggcggcagggaattg
ctgggagaaacgctaaccgaacgcggcgtgcaggtgacctactgcgaatgctatcagcgc
agagacgttcattatgatgggccggagcaaagccgccactggcaacaaataggcatcgac
aaactggtgatcaccagcggagaaatgctacaacggatctatactttagtacctgattac
tatcgggcttcctggttactcggctgccgcttgatcgtcgtcagtgaacgactggcagaa
caggctcgtcagcttggctggcgcgatatccgggtcgccgataacgccgataacgatgcg
ctcgtgcgcgcactacaataa

DBGET integrated database retrieval system