KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_3981Help
Entry
PC1_3981          CDS       T00934                                 

Definition
Uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:pct00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PC1_3981
Enzymes [BR:pct01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     PC1_3981
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4492025..4492765
Genome map
AA seq 246 aa AA seqDB search
MTILVTRPSPTGEQLVTRLRKLGYNAWHSPLIEFSPGRELASLPALLQTLRADDLVFALS
QHAIHYADPMLARAGIGWPAHLAYYAIGRTTALALHKTSAHPVIYPPERETSETLLQLPE
LQNISGKRALLLRGNGGRELLGETLTERGVQVTYCECYQRRDVHYDGPEQSRHWQQIGID
KLVITSGEMLQRIYTLVPDYYRASWLLGCRLIVVSERLAEQARQLGWRDIRVADNADNDA
LVRALQ
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgacaattctggttacccgtccgtcaccaactggcgaacaactggtgacccgtttaaga
aagcttggctataacgcctggcacagcccgctgatcgagttttcacccggacgagaactt
gccagcttgccagcactattacagacgctgcgcgccgacgatctggtgtttgcgctctca
caacatgcgattcattacgccgatccaatgctggcgcgtgcgggcatcggttggcctgcc
catctcgcttattatgcgattggtcgcaccacggcactggcgctgcataaaaccagcgcc
catccggtcatctaccctcccgaacgcgaaaccagcgaaacgctcctgcaactacctgaa
ctgcaaaatatttccggcaagcgcgcactattactgcgcggcaacggcggcagggaattg
ctgggagaaacgctaaccgaacgcggcgtgcaggtgacctactgcgaatgctatcagcgc
agagacgttcattatgatgggccggagcaaagccgccactggcaacaaataggcatcgac
aaactggtgatcaccagcggagaaatgctacaacggatctatactttagtacctgattac
tatcgggcttcctggttactcggctgccgcttgatcgtcgtcagtgaacgactggcagaa
caggctcgtcagcttggctggcgcgatatccgggtcgccgataacgccgataacgatgcg
ctcgtgcgcgcactacaataa

DBGET integrated database retrieval system