KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_4044Help
Entry
PC1_4044          CDS       T00934                                 

Definition
fatty oxidation complex subunit alpha FadB
Orthology
K01825  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pct00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PC1_4044
   01212 Fatty acid metabolism
    PC1_4044
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PC1_4044
   00650 Butanoate metabolism
    PC1_4044
  Lipid metabolism
   00071 Fatty acid degradation
    PC1_4044
   01040 Biosynthesis of unsaturated fatty acids
    PC1_4044
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PC1_4044
   00310 Lysine degradation
    PC1_4044
   00380 Tryptophan metabolism
    PC1_4044
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PC1_4044
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PC1_4044
   00281 Geraniol degradation
    PC1_4044
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    PC1_4044
Enzymes [BR:pct01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     PC1_4044
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PC1_4044
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     PC1_4044
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     PC1_4044
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4573216..4575405
Genome map
AA seq 729 aa AA seqDB search
MLYQGESLYLNWLEDGIAELVFSAPGSVNKLDTRTVASLGKALDVLAEQPNLKGLLLRSD
KPAFIVGADITEFLSLFAAPAEKLHEWLVFANRIFSRLEDLPVPTLSAINSYALGGGCEC
VLATDFRLATPDARIGLPETKLGIMPGFGGTVRLPRLLGTDSALEIIAAGKDVSAADALK
VGLVQAVVTNDKLVPAAIKMLKQAINGSLDWQAYRRPKLEALKLNKIEAMMSFTTAKAIV
LQTAGKHYPAPMLAVKTIEAAATMTRDDALQLETQHFVQLARSNEARALVGIFLNDQYVK
GKAKKLIGETPVPQQAAVLGAGIMGGGIAYQSAFKGVPIRMKDINEKPLALGMNEAAKLL
NKQMERGKLDGMKMATILASIQPTLDYAGFERTNIVVEAVVENPKIKASVLAETESHVSE
NTILASNTSTIPIASLAASLKRPQNFCGMHFFNPVHRMPLVEIIRGPKTSDSTIASVVAY
ASKMGKTPIVVNDCPGFFVNRVLFPYFAAFSLLLRDGADFREIDNVMEKKFGWPMGPAYL
LDVVGIDTAHHAQAVMAAGFPQRMAKDYRDAIDVLFEHQRFGQKNGQGFYRYQTDSKGKP
RKEQDEAVNTLLKDISQPTKAFSAEEIIARMMIPMINEVARCLEEGIIASPAEADMALVY
GLGFPPFHGGACRYLDTLGSERYVEMAQQLAHLGAIYQVPDGLQQKARSNEGYYPSVAPH
ADVSHGQPA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctttatcaaggtgaatccctctaccttaactggcttgaggacggcattgccgagctg
gtattttctgcccctggctccgtaaacaagctagatacccgcacggttgccagcctgggt
aaggcgctggacgttctggcggaacagccgaatctgaagggcttactgctacgctctgac
aaacctgcatttattgtcggtgccgatatcacggaattcctttccctttttgccgcaccg
gccgaaaagctgcatgaatggcttgtcttcgccaaccgcatttttagccgtcttgaggac
ttacccgttcccacgctgtccgcgattaatagctatgcactgggaggcggttgtgaatgt
gtactggcaactgactttcgtttagcgacgccggatgcgcgtatcggcttaccagaaacg
aagctagggatcatgccgggttttggcggcacggtcagattgccgcgcctgctgggtaca
gatagcgcattggaaattatcgccgccggtaaagacgtcagcgcagccgatgccttaaaa
gtaggactggttcaggccgtggtgaccaatgacaaactggttcccgctgccatcaagatg
ttgaaacaggcgattaacggctcactggactggcaggcttatcggcgcccgaaacttgaa
gcgctgaagctcaataagattgaagccatgatgagctttaccaccgccaaagcgatagtg
ctacaaaccgccgggaagcactatccagcgcccatgttagcggtcaaaactatcgaagcc
gccgcgaccatgacgcgcgatgacgcattgcaactcgaaacgcagcacttcgttcagttg
gcgcgttccaatgaagctcgggcactcgtcggcattttcctcaacgatcagtatgttaaa
ggtaaagcgaagaagttgattggcgagacaccggtgccgcagcaagcggccgttctgggt
gcaggcattatgggcggcgggattgcctatcaatccgcgttcaaaggcgtgccgattcgg
atgaaagatatcaatgagaagccgcttgcgctggggatgaatgaagccgccaagctcctg
aataaacaaatggaacgaggcaagctggatggaatgaaaatggcgacgattctggccagc
attcagccaacgctggattacgccggctttgagcgcaccaacatcgtggttgaggccgtg
gttgagaacccaaaaatcaaagccagtgtactcgccgaaactgaatcgcacgttagcgag
aatacgattctggcttcgaatacctccaccatcccgattgcttcgctcgccgcatcgcta
aaacggccgcaaaatttctgcggaatgcacttcttcaacccagtacaccgcatgccgctg
gtcgaaattattcgcggccctaaaaccagcgacagcaccatcgccagcgtagtggcttac
gccagcaaaatgggtaaaacgccaattgtcgtgaacgactgccccggattcttcgtgaat
cgggtgctgttcccctactttgctgcattcagcttactgctcagagacggtgccgatttc
cgcgagatcgataacgtcatggagaaaaaattcggttggccgatgggtccagcttatctg
ctggatgtagtcggcattgacaccgctcaccatgctcaggccgtcatggccgctggcttt
ccacagcgtatggcaaaagattaccgcgatgcgattgatgtattgtttgagcatcagcgc
tttgggcagaaaaacggtcagggcttctaccgctatcaaaccgatagcaaaggcaagccg
cgtaaagagcaggatgaagccgtaaatacgctccttaaagacattagccaaccgacaaaa
gcgttcagtgcagaagagattatcgctcgtatgatgatcccgatgattaatgaagtcgca
cgctgtctggaggaaggtatcatcgccagccctgccgaagcggacatggcgctggtatac
gggctgggtttccctcccttccacggcggtgcctgccgctatctggatacattgggcagc
gaacgttatgtcgagatggcgcaacagttggcgcacctcggcgcaatctatcaggtgcca
gacggcttgcagcaaaaagccagaagcaatgaaggctattacccatcggtcgcgccacac
gcggacgtttcccacggtcaaccggcatga

  All links  
No link information was found.   
DBGET integrated database retrieval system