KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_4209Help
Entry
PC1_4209          CDS       T00934                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:pct00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PC1_4209
Enzymes [BR:pct01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     PC1_4209
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4757070..4757693
Genome map
AA seq 207 aa AA seqDB search
MAQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSISHTTRAKRPGENHGEHYFFVEVD
EFKRMIQDNEFLEHAEVFGNYYGTSRPAIEQVLATGVDVFLDIDWQGAQQIRAQMPHARS
IFILPPSKEELARRLRGRGQDSDDVIARRMSQAVAEMTHYGEYDYLIVNDDFDLALLDLK
TIIRAERLRLSRQQVRHDALITKLLAD
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaggcacgttatatatcgtttctgctcccagtggagccgggaaatccagcctg
attcaggcgttattaaaaacccagccgctttacgacactcaggtatcgatttcgcatacc
actcgggctaaacgaccgggagaaaaccacggcgaacactatttcttcgtcgaagtcgat
gaatttaagcgtatgattcaggataacgagtttctggaacacgctgaagtctttggcaat
tactacggtacatcccgaccagccattgagcaggtattagcgacgggtgttgatgtcttt
ctggatatcgactggcaaggcgctcagcaaatccgtgcccagatgccgcacgcgcgcagt
attttcattctgccgccgtcaaaagaagaactggctcgccgcctgcgtggccgtggacag
gacagcgatgacgtcattgcccgccgtatgtctcaagctgtggctgaaatgacgcactac
ggcgagtatgattacttgattgtgaatgatgatttcgatttggcgttgctcgatctgaaa
accattattcgcgccgaacgtctgcgtttgagcagacaacaggttcggcatgatgcatta
atcaccaaactattggcagactga

DBGET integrated database retrieval system