KEGG   Candidatus Protochlamydia amoebophila: pc0010Help
Entry
pc0010            CDS       T00172                                 

Gene name
recD
Definition
exodeoxyribonuclease V alpha chain recD
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
pcu  Candidatus Protochlamydia amoebophila
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pcu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    pc0010 (recD)
Enzymes [BR:pcu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     pc0010 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
18855..20723
Genome map
AA seq 622 aa AA seqDB search
MKVMERGFAKQNFLESYKLAPWLGTKRAQDLPNWPLVNQLLSKNQLSYLNYLLTLEIIKD
QWINQNLVLFICHLLMAAQEGHLCVEIRNQTLFPTVKQLWTNEAAAPLSNEELENLTHSI
LQGSQNIPVNFVTAMDSLENSVYPNTPICMHKGNFYLQKHWVLETVFLKNLNKHLQTSPT
LELNRVVLEQHLNECVLKKKLLLEQAQAILTGCLSSLSLITGGPGTGKTFTAGRFIQIYW
DSLKECQKKNCQIALAAPTGKAAANLQKSLSLVTAQLKDFPPLKAKTLHQLLGINNRSRN
ESGIRLAADLIIVDESSMIDVKMMAYLFEALKKGSRLILLGDQHQLPSVEAGSLFADLTK
LKTKIPCTELKVCLRTELSSIVSLAHYINQGKGQETLSMLNETQIAGISRLNLSPDRREA
QKEFVQHVMNHFPLSIKVHDNQKILELFNTIRILSPMRKGYFGVDSINQLIWNHVSQIKL
SPGWLAIPIIIVTNDYKQNLFNGETGVLIRKLPLKSITSEDYALFPSKDEGENMRCLPAC
LLPKYELAYCLSVHKSQGSEFERVILMLPEGSECFGREVFYTGVTRARKHIEVWGTDFTI
EKTISQQSFRLSGIQTRLEKFI
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggtaatggaaagaggattcgcaaagcaaaattttttagaatcatataagttagct
ccttggttgggcacaaaaagagctcaagacttaccgaattggcccctcgttaatcagtta
ttaagtaaaaatcaactttcttatttaaactatcttttaactttagaaattattaaagat
caatggatcaatcaaaaccttgtgttgtttatttgccatcttttgatggctgctcaagag
gggcatttatgcgtggaaatcaggaatcagactttatttcctacggtaaaacaactttgg
acgaatgaagcggcagcaccgttatctaatgaagagttagagaatttaacccattcaatt
ttgcagggatcacaaaatattccggttaattttgtgacagctatggatagccttgaaaat
tctgtttatccgaatactcccatatgtatgcataaaggcaatttttatttgcaaaaacat
tgggttttggaaacagtttttctaaaaaatttaaacaaacatttacaaacatccccaacg
cttgaattaaatcgagttgttcttgaacaacaccttaatgaatgtgtgttgaaaaaaaaa
ttgttattggaacaagctcaagcaattttaacaggatgcttatcgtctctttcacttatt
actggtggacctggaaccggaaaaacttttacggctggccgttttattcaaatttattgg
gatagtttaaaagaatgtcagaaaaaaaactgccaaattgctttagcagcaccgacgggt
aaagctgctgcaaatttacaaaaaagtttgagtttagtcaccgcgcagttaaaagatttt
cctcctttaaaagcaaaaactttgcatcaattattgggaattaataatcgctcaagaaat
gaatctggtataagattagcagcggatttgattattgtagatgaaagttcgatgatcgat
gtcaaaatgatggcttatttatttgaagctttaaaaaaaggctcgcgactgattttactc
ggtgatcagcatcaattaccttctgtggaagcaggaagtttatttgctgatttgacgaaa
ttaaaaacaaaaattccctgtacagaactgaaagtttgtttacgcacagaattaagctct
attgtttcattggcgcattatattaatcaaggaaagggtcaagaaacgttgagcatgctt
aacgaaacacagattgctgggatttctcgtttaaatttgtctccagatagaagagaagcg
caaaaagaatttgtccagcacgttatgaatcattttcctttatctataaaagttcacgat
aatcaaaaaatattagagctttttaataccattcgtattttatcacctatgcgaaaaggg
tattttggagtagatagcattaatcagctcatttggaatcatgtgagccaaataaaacta
tcaccagggtggttagcaattcctattattattgtcacgaatgattacaaacaaaatttg
ttcaatggcgaaactggtgtgttaattcgaaaactacctttaaaatcaataacgagcgaa
gattatgctttatttccttctaaagatgagggagaaaatatgcgttgtttacccgcttgt
ttacttcctaagtatgaattagcttattgcttatctgtccataagagtcagggcagcgaa
ttcgagagagtcattttaatgttacctgaaggatcggaatgctttggtagagaagttttt
tatactggcgttacgagggctcgtaaacatattgaggtgtggggaaccgatttcacaatt
gaaaaaacaatttctcaacaaagttttcgcttatctgggattcaaacgcgtctggaaaaa
tttatttaa

DBGET integrated database retrieval system